KEGG   Alternaria alternata: CC77DRAFT_1092893Help
Entry
CC77DRAFT_1092893 CDS       T05291                                 

Definition
(RefSeq) glycogen synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
aalt  Alternaria alternata
Pathway
aalt00500  Starch and sucrose metabolism
aalt01100  Metabolic pathways
Module
aalt_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:aalt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CC77DRAFT_1092893
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:aalt01003]
    CC77DRAFT_1092893
Enzymes [BR:aalt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     CC77DRAFT_1092893
Glycosyltransferases [BR:aalt01003]
 Polysaccharide
  Storage polysaccharide
   CC77DRAFT_1092893
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_transf_5
Motif
Other DBs
NCBI-GeneID: 29115247
NCBI-ProteinID: XP_018387779
JGI: 1092893
UniProt: A0A177DSF4
Position
Unknown
AA seq 705 aa AA seqDB search
MAETGARDVQNHVLFEVATEVANRVGGIYSVLKSKAQVTTAEYGAAYTLLGPWNRASAAV
EVEPIEPKDPALVATIKSMDDRGIKTLYGRWLIDGAPRVLLFDTGTGYRWLDEWKGDLWS
STGIPSPPGDSETNEAIVFGYLIAWFLGEYVYHEKKRAVIVQFHEWLAGVAVPLCKKRRI
DVTTIFTTHATLLGRYLCAGSVDFYNNLQYFDVDAEAGKRGIYHRYCIERAATHAADVFT
TVSHITAYESEHLLKRKPDGVLPNGLNVKKFSATHEFQNLHQQAKVKINDFVRGHFYGHN
DFDPENTLYFFTAGRYEYRNKGVDMFIESLARLNHKMKSENSNMTVVAFIILPAQTTSLS
VDSLKGQAVIKALHDSVNNIAENVAKKLFERSLTWTEGSELPEDKDLITPADKILLRRRL
FAMKRHNLPPIVTHNMVNDAEDPVLNQLRRCQLFNHPSDRVKVVFHPEFLNSANPVLPLD
YDDFVRGTHLGVFSSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENAQDYGIYI
VDRRMKGVDDSVNQLVDYMFEFTKKSKRQRINQRNRTERLSDLLDWKRMGLEYVKARQLA
LRRAYPAAYEDDDEPDFFSSQDVKISRPLSEPGSPRDRSGMMTPGDFASLQEGREGLSTE
DYIAWKLPEEEEADDFTFPLTLKTKSKPNSGANTPTLSTAPNGTD
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaccggcgcgagagacgtgcagaaccacgtcctgttcgaggttgcgactgaa
gtcgcaaacagagtcggcggtatctactcagtcctcaagtccaaagcgcaagtcactacg
gccgagtatggcgccgcatacactctcttgggtccatggaacagggcttcggcggctgtc
gaagttgagccaatcgagcccaaagatccagccttggttgcgaccatcaagtccatggac
gaccgtggcatcaagacgctgtatggacgttggttgatcgacggtgccccacgtgtgctc
cttttcgacaccggtactggttacaggtggcttgacgagtggaagggcgacctttggtct
tccaccggcattccctcgcctcccggcgattctgagaccaatgaggccattgtctttggt
tacctcatcgcatggttcttgggcgagtatgtctaccatgagaagaagcgagccgtcatt
gtccagttccacgagtggctggccggtgtcgcagttcctctgtgcaagaagcgccgaatc
gatgttactaccatcttcactacccacgctacgctccttggtcgctacctctgcgccggc
tcagtcgatttctacaacaatcttcaatatttcgacgtcgacgctgaggcaggaaagcgt
ggtatttaccaccgttactgcatcgagcgtgccgctacacacgcggctgacgtgttcacg
acggtttcacacatcaccgcatacgagagcgagcatcttttgaagcgaaagccggatggt
gttctgcccaatggtctgaacgtcaagaagttctccgctacccatgagttccaaaacttg
catcagcaagccaaggtcaagatcaacgatttcgtgcgcggtcatttctacggtcacaac
gactttgatccagagaacactctttacttcttcaccgctggtcgctacgagtaccggaac
aagggtgtcgacatgttcatcgaatcgttagcgcgattgaaccacaagatgaagagcgag
aactcgaatatgacagttgttgctttcatcattctgccggcacagaccacctctctttcg
gtcgactcattgaagggacaggctgtcatcaaggcgctccacgacagtgtaaacaacatt
gccgaaaatgtagccaagaagctgtttgagcgctcgttgacatggacagagggctccgag
cttccagaggacaaggacttgattacgcctgctgacaagatcttgctccgccgaagattg
ttcgccatgaaacgccacaacctcccgcctattgttacccataacatggtcaacgatgct
gaagaccccgtgttgaaccagctccgtcgctgtcaactcttcaaccacccatcggatcgc
gtcaaggttgtcttccatcccgaattcttgaactccgcaaatcccgtcctgccattggat
tatgatgacttcgtccgtggaacccatcttggtgtcttctcatcgtactacgagccttgg
ggctacactccagctgagtgcactgttatgggtgttcctagcatcacaaccaacttgtct
ggtttcggttgttatatggaggaattgatcgagaacgcccaggattacggtatctacatc
gtagaccgaaggatgaagggtgtcgacgactcagtcaaccagcttgtcgactacatgttc
gagtttacaaagaagagcaagcgccaacgtatcaaccagcgtaaccggaccgagcgtctc
agtgatctgctcgactggaagcgcatgggcttggagtacgtcaaggctcgacaattggct
cttcgacgagcataccctgcggcatatgaagacgatgatgagccagacttcttcagctcg
caagatgtcaagatctcgcggccgttgtctgagcctgggtctccccgggaccgttcgggt
atgatgacgcctggtgactttgcttcgcttcaagaaggtcgcgaaggactgagcactgag
gattacatcgcgtggaagcttccggaagaagaagaggccgatgactttaccttcccgctt
accttgaagacgaagagtaagcctaattcaggcgcaaacactcccactctgtctactgcg
ccgaatggtactgactag

DBGET integrated database retrieval system