KEGG   Alternaria alternata: CC77DRAFT_556163Help
Entry
CC77DRAFT_556163  CDS       T05291                                 

Definition
(RefSeq) cellulase
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
aalt  Alternaria alternata
Pathway
aalt00500  Starch and sucrose metabolism
aalt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aalt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CC77DRAFT_556163
Enzymes [BR:aalt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     CC77DRAFT_556163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_6
Motif
Other DBs
NCBI-GeneID: 29117757
NCBI-ProteinID: XP_018380152
JGI: 556163
UniProt: A0A177D5P8
Position
Unknown
AA seq 389 aa AA seqDB search
MVQLTQLVLASAAFAGAVSAAPKPPPSNVSINPWTGKDRYVVQSYGKKLDQTIASFTAQN
DTLNAARTRTVAQKISTFTWVTTRDGLSLIPTAIKEARQQRKPGKKMIVGLVLYNLPDRD
CSAGESAGELSLANNGLEIYKKEFVDKYAKLVSQAKDLDFAIVLEPDSLGNAITNQGVPF
CATATPAYEEGIAYAIAKLQFPNVHLYMDAAHGGWLGWADNLKPTAQIFAKVVAMAKKLN
PAAKIRGYATNVSNYNSFQAKVRENYTEYSPSWDESHYASSLAPYLEAEGLPSNFIIDQG
RVALPGARAEWGEWCNVEPAGYGSLPGSKQNNTNVDSLVWIKPGGESDGKCGLAGAPAAG
AWFDEYVQMLVKNADPPLEPTYLKKPKGL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaactcacacagcttgttttggcatccgccgccttcgctggtgctgtatctgca
gctcccaagccacctccaagcaatgtatctatcaacccttggactggtaaagaccgctat
gtcgtccagagctacggcaagaaactcgaccagaccatcgcctccttcacggcccagaac
gacaccctcaatgcggcgcgcacccgcacagttgctcagaagatctcaaccttcacttgg
gttactacacgtgatggccttagcctcattcctactgccatcaaggaagctcgtcaacaa
aggaagcccggaaagaagatgatcgttggtctggtcttgtacaacttgcccgatcgtgat
tgctccgcaggagaatccgccggcgagctcagtctggcgaacaacggcctcgagatctac
aagaaggagtttgtcgacaagtacgccaagcttgtttcccaggccaaagatctcgacttc
gctattgttctcgagccggactcccttggtaacgccatcacaaaccagggcgtccctttc
tgtgctaccgctactcccgcctacgaagagggtatcgcgtacgccattgccaagctgcag
ttccccaacgtacatttgtacatggatgctgcgcacggcggctggctcggctgggcggac
aacctgaagcccaccgctcagatctttgccaaggtcgtcgctatggcaaagaaactcaac
cccgcggccaagatccggggttacgccaccaacgtatccaactacaactccttccaagcc
aaggtacgcgagaactacaccgagtactcgccatcttgggacgagagccactacgcctcg
tcgctcgctccttacctcgaggctgagggtctaccatccaacttcatcatcgaccagggc
cgcgtcgcccttcctggggctcgtgcggagtggggtgagtggtgcaatgttgagcctgct
ggatatggctctctacccggttcgaagcagaacaacaccaacgtcgactctctagtctgg
atcaagcctggtggcgagagtgatggaaagtgtgggcttgctggtgcgcccgctgctggt
gcttggttcgatgaatatgtgcaaatgttggtgaagaatgctgatccaccactcgagccg
acctacctgaagaagcctaagggtctctaa

DBGET integrated database retrieval system