KEGG   Alternaria alternata: CC77DRAFT_936302Help
Entry
CC77DRAFT_936302  CDS       T05291                                 

Definition
(RefSeq) exoglucanase-like protein 1 precursor
  KO
K01225  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
aalt  Alternaria alternata
Pathway
aalt00500  Starch and sucrose metabolism
aalt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aalt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CC77DRAFT_936302
Enzymes [BR:aalt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     CC77DRAFT_936302
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_7
Motif
Other DBs
NCBI-GeneID: 29120081
NCBI-ProteinID: XP_018385458
JGI: 936302
UniProt: A0A177DKY7
Position
Unknown
AA seq 456 aa AA seqDB search
MYRTLALASLSLFGAARAQQVGKETTETHPKMTWQTCTGTGGKSCTNKSGSIVLDSNWRW
AHVTSGYTNCYDGNSWNTTACPDGSTCTKNCAIDGADYSGTYGITTSSNSLSLKFVTKGS
YSANIGSRTYLMESDTKYQMFNLIGKEFTFDVDVSKLPCGLNGALYFVEMAADGGINKGN
NKAGAKYGTGYCDSQCPHDIKFINGVANVEGWNPSDNDSNAGQGKMGACCPEMDIWEANS
ISTAYTPHPCKGTGLQECTDDVSCGDGDNRYGGICDKDGCDFNSYRMGVRDFYGPGMTLD
TTKKMTVVTQFIGSGSSLSEIKRFYIQGGTVFKNSDSAIEGVSGNSITEKYCDQQKTAFG
DTSSFKTLGGLNEMGASLARGHVLVMSLWDDHAVNMLWLDSTYPTDADPEKPGIARGTCA
TDSGKPEDVEANSPGATVVFSNIKFGPIGSTFAQPA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtacaggacactcgccctcgcttctctctcgctcttcggagccgcccgcgctcagcag
gttggcaaagagacaacggagacacaccctaagatgacatggcagacttgcactggtacc
ggcggaaagagctgcaccaacaagtctggttccattgtgctcgactccaactggcgatgg
gcccacgtcaccagcggctacaccaactgctacgacggcaactcttggaacacgaccgct
tgccctgacggcagcacttgcaccaagaactgcgccatcgacggtgccgactactctggt
acctacggtatcactaccagcagcaactctctgtccctcaagttcgtcaccaagggctct
tactctgccaacattggttcgcgtacctacctcatggagagcgacaccaagtaccagatg
ttcaacctcatcggtaaggagttcaccttcgacgtcgacgtctccaagctgccttgcggt
ctgaacggtgctctctactttgttgagatggctgccgacggtggtatcaacaagggcaac
aacaaggctggtgccaagtacggaactggatactgcgactcccagtgcccccacgacatc
aagttcatcaacggtgtagccaacgtcgagggctggaacccgtccgacaacgactccaac
gccggccagggcaagatgggtgcctgctgccccgagatggacatctgggaggccaactcc
atctccactgcctacactccccacccctgcaagggcactggtctccaggagtgcaccgac
gacgtcagctgcggtgacggcgacaaccgctacggcggaatttgcgacaaggacggctgc
gacttcaacagctaccgcatgggcgtccgtgacttctacggcccaggcatgaccctcgac
accaccaagaagatgactgtcgtcactcagttcatcggctccggttccagcctctccgag
atcaagcgtttctacatccagggaggaaccgtcttcaagaactccgactccgccatcgag
ggcgtcagcggcaactctattactgagaagtactgtgaccagcagaagaccgccttcggt
gacacatcttctttcaagactctcggtggtcttaacgagatgggtgcctcgcttgctcgc
ggccacgtcctcgtcatgtccctctgggacgaccatgcggtcaacatgctctggctcgac
tctacctaccccaccgatgccgacccagagaagcctggtatcgcccgtggtacctgcgct
accgactctggcaagcccgaggacgttgaggccaactcgcccggcgcgactgtcgtcttc
tccaacatcaagtttggtcccattggctccacctttgcccagcccgcataa

DBGET integrated database retrieval system