KEGG   Alternaria alternata: CC77DRAFT_937904
Entry
CC77DRAFT_937904  CDS       T05291                                 

Definition
(RefSeq) nitrite reductase
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
aalt  Alternaria alternata
Pathway
aalt00910  Nitrogen metabolism
aalt01100  Metabolic pathways
Module
aalt_M00531  Assimilatory nitrate reduction, nitrate => ammonia
aalt_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:aalt00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    CC77DRAFT_937904
Enzymes [BR:aalt01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     CC77DRAFT_937904
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Rieske Pyr_redox Fer2_BFD Rieske_2 NIR_SIR_ferr Rubredoxin_C GIDA K_oxygenase
Other DBs
NCBI-GeneID: 29120172
NCBI-ProteinID: XP_018384755
JGI: 937904
UniProt: A0A177DHF3
Position
Unknown
AA seq 1157 aa
MAETEPIVTQGIEPSSGESHSPPGDRHITATWGSKDGNISNAEWNDAEANKLPEKVADLE
KKGEINDQHPRKKIVVVGLGMVGIAFIEKLMKYDVKRREYDVVVIGEEPHLAYNRVGLTS
FFQHRQVENLYLNPKEWYASMPEGSLNYHLNTLVTEIDSTEKNVKTSSGETVPYDILVLA
TGSDALLPRHTPGHDANGVFVYRTIEDLQRLIEFSSTRKGTTGAVVGGGLLGLEAAHAMM
DLEDFAKVKLIERNRWVLSRQLDGDAGGMVVEQVRALGLDVMLSKRVGKILTTEDNFVKG
VVFEDGDEMECSCICFAIGIKSRDELARKAGIKCADRGGGIVVGPDLATSQTDIYAVGEC
ASWENQTFGLIAPGVEMADVLAFNLTQAKAHAPRKFKAPDLSTKLKLLGVEVASFGDFFA
DRDGPKNMPGRQRAEKKEVNGATPRDRVKNLTDGPAPPPVKALTYKDPFQQVYKKYLFTM
DGKYLLGGMMIGDTKDYIKLVPLVKNQKQLEMAPSELIVGAQKGDDDGSDLSGDTQICSC
HNVTKDDVVNATKDGTCKSIGDVKSCTKAGTGCGGCMPLVQTIFNKTMASMGNEVKNHLC
PHFEYSRADLFNIIYVKGLKDFAAVMKEAGKDPNSLGCEACKPTIGNIVASLYNKHLLEV
NNRGLQDTNDRFLANIQRNGTFSVVPRVSGGEITPEKLIIIGTVAKKYNLYTKITGGQRI
DMFGARKQDLPDIWQELIDGGMESGHAYAKSLRTVKSCVGTTWCRFGIGDSVGMAVRLEE
RYKSIRGPHKIKGGVSGCVRECAEAQNKDFGLIATEKGFNIFVGGNGGAKPRHSELLAKD
VPPDDVVPILDRYLSFYIRTADKLQRTARWMENLPGGIKYLQEVILEDKLGICADLEKQM
EDLVGTFFCEWTEVLKDPKKRSWFSQFANTSETIVDTIEPTQERGQERPSYWPKDSITED
FRGTKWTELSWQPLVKAEEFKDADTGDSKAIKRGDTQLAVFKVRGKYYCTQQMCPHKRAF
VLSDGLIGDDLANNKLWVSCPYHKRNYELSGDNAGKCANDESVNIAVFPIEERGDGWLYV
KLPSVEELDSVLGTSKFKIKKSETEDPFVALDKKLQRLQLKGRKGMQVSHLEGGLGEKAK
AAQILAGGERGAGGLDW
NT seq 3474 nt   +upstreamnt  +downstreamnt
atggccgagacggagccaatcgtcacacaaggcatcgagccctcatccggcgaatcacac
tcaccacccggcgaccgccatatcacagcaacatggggatcgaaggacggaaacatctcc
aatgcagaatggaacgatgcggaagccaacaagctgcctgagaaggtagctgatttagag
aagaagggcgagatcaacgatcaacatccacggaagaagatcgtggttgttggattgggt
atggtgggcatagcgttcatcgagaaactcatgaagtatgacgttaagcggagagagtat
gatgttgtagttattggcgaggaaccacatcttgcgtacaaccgggtcggtttgacaagc
tttttccaacatcggcaagttgagaacttatatcttaaccccaaggaatggtatgcgtcg
atgccagaaggttcattgaactatcacctgaacaccctcgttaccgagatcgactccacc
gaaaagaacgtcaagacttcatccggcgaaacagtaccctacgatatcttggtactagca
acgggatccgacgcccttcttcctcgacatacacccggccacgacgcaaacggtgttttc
gtataccgcacaatagaggaccttcaaagactgattgaattctcctcaacaaggaaaggt
actacaggcgcggtcgtaggtggtggtctactaggtttggaagctgcacatgcaatgatg
gaccttgaagacttcgcaaaagtgaagctcattgagcggaatcgatgggtcttgtcaaga
caactggatggggatgctggtggtatggttgttgagcaggtccgagctctaggcctggac
gttatgttaagcaagagagtgggcaagatcttgaccacagaggataacttcgtcaaggga
gttgtctttgaggatggtgacgagatggagtgctcttgtatatgctttgcgattggtatc
aaatcacgagacgagctcgcccgtaaagcaggcatcaaatgtgctgatcgaggaggtggc
attgtggtcggacccgacctagcaacctcgcaaactgacatctacgctgtaggcgaatgt
gccagttgggagaaccaaacgttcggcctcatcgctcccggtgttgaaatggcagacgtc
cttgccttcaatctcactcaagcgaaagcgcatgcgccccggaaattcaaagcccccgac
cttagcactaagctcaagttgcttggtgttgaagtggcaagtttcggtgacttcttcgca
gaccgcgacgggccgaagaatatgcctggacggcaacgagctgagaaaaaggaggtcaac
ggagcgacgccgagagatcgcgtcaagaacctgacggatgggccggcaccaccacctgtc
aaggcgctgacctacaaggacccgttccagcaggtgtacaaaaaatatctgtttaccatg
gacgggaaatacttgttgggtggcatgatgatcggtgatacgaaagactacatcaagctc
gtgccgctggtgaagaaccagaagcagctggagatggcgccaagcgagcttatcgttggt
gcacagaagggcgatgatgacggttcagatctatctggcgatacacagatttgctcatgc
cacaacgtcaccaaagacgatgtagtcaatgctaccaaggacggaacatgcaaaagcatc
ggcgacgtcaagtcatgcaccaaagccggcaccggatgtggaggttgcatgccactcgtg
caaacaatcttcaacaagaccatggcttctatgggtaacgaagtcaagaaccatctttgc
ccacactttgagtactcccgcgccgatctcttcaacatcatctatgtaaagggcttgaag
gactttgccgctgtcatgaaggaagccggaaaagatccgaattccctgggctgcgaagcc
tgcaagccgactattggaaacattgtcgcttcgctgtacaacaaacatctactggaggtc
aacaacagaggtctgcaagatacgaacgacagattcctggccaacatccagcggaacggc
acgttctccgtcgttccccgagtttctggcggtgagattaccccagagaagctcatcatt
atcggtaccgtcgcgaagaagtacaacctctacaccaagattacgggcggtcagcgtatc
gatatgtttggtgcgcggaaacaagaccttcctgatatttggcaagaactcattgatggt
ggaatggagtcgggtcacgcatacgccaagtcattaagaacagtcaagtcatgtgtcgga
accacgtggtgccgattcggtatcggcgacagtgttggtatggcagtgcgtctagaagag
cgctacaagtccatccgtgggcctcacaagatcaagggtggagtatctggttgcgtacgt
gaatgcgccgaggcacagaacaaggactttggtctcattgctactgagaagggtttcaac
atcttcgtaggtggcaacggtggtgcgaagcctcgacactcggaacttctcgccaaggac
gtcccaccggatgatgtagtgcccattctcgaccgctacctgtctttctacattcgcaca
gccgacaagcttcaacggacagcgcgctggatggagaacctacccggcggcatcaagtac
ctacaggaggtcatcctcgaagacaagctaggcatctgcgcagacctagagaagcaaatg
gaagaccttgttggtaccttcttctgcgaatggaccgaagttctcaaggatcccaagaag
cgctcctggttctcacaattcgcaaacacttccgagaccatcgtcgacaccattgaaccc
acccaagagcgtggtcaagaacgcccatcctactggcctaaagactcgatcacagaagac
ttccgtggcacaaaatggacagaattgtcttggcaacccctcgtcaaagccgaagagttc
aaagacgccgacacgggtgatagtaaggccatcaagcgcggcgacacccaactcgctgtc
ttcaaggtccgtggcaagtactattgtactcagcagatgtgcccgcacaagcgtgctttc
gtcctctccgacggtctcatcggcgacgatcttgccaacaataaactgtgggtcagctgc
ccgtaccataagcgcaactacgaactatcgggcgacaacgcaggaaaatgcgccaacgat
gagagcgtcaacatcgctgttttccctattgaggagcgcggtgatgggtggctgtatgtc
aagttgcctagtgtagaggagctggacagtgtacttggtacaagtaagttcaaaatcaag
aagagcgagacggaagatccattcgttgctctagataagaagttgcagaggctgcaactg
aaaggaaggaaggggatgcaggtttctcatcttgagggtgggttaggggagaaggcaaag
gcggcgcaaatactcgctggtggagagaggggtgctggaggcttagactggtag

DBGET integrated database retrieval system