KEGG   Alternaria alternata: CC77DRAFT_97701Help
Entry
CC77DRAFT_97701   CDS       T05291                                 

Definition
(RefSeq) succinyl-CoA ligase subunit alpha
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
aalt  Alternaria alternata
Pathway
aalt00020  Citrate cycle (TCA cycle)
aalt00640  Propanoate metabolism
aalt01100  Metabolic pathways
aalt01110  Biosynthesis of secondary metabolites
aalt01130  Biosynthesis of antibiotics
aalt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aalt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CC77DRAFT_97701
   00640 Propanoate metabolism
    CC77DRAFT_97701
Enzymes [BR:aalt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     CC77DRAFT_97701
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CC77DRAFT_97701
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ligase_CoA CoA_binding Succ_CoA_lig ATP-grasp_2
Motif
Other DBs
NCBI-GeneID: 29121554
NCBI-ProteinID: XP_018385545
JGI: 97701
UniProt: A0A177DJK0
Position
Unknown
AA seq 724 aa AA seqDB search
MLSQQVRILRNNVRTAQKPCRRTPCATFSVSSRRNNYDDTIQNLKIGSHTRVIFQGFTGK
QATANARESIEWGTNVVGGVKPNGSGEHLGLPVLPSVRAAMEQLKPDATGIYVAAHQATA
AIEEAIEAEVPLIVAVAEHIPLHDMMRIHSMLQSQSKSRLVGANAPGIISAIGKCRIGFQ
PLPTFSPGHIGIVAKSGTLSYETVGSLTRAGVGQSLCIAVGGDVIAGTNFVDALKVFEHD
EDTKAIIIVGELGGTTEEEAADWINDYKRRVKNPKPIAAVIGGFEAPHGKVMGHAGAWVG
LGEGTAASKYKALENAGVTMVDHPAKFGGVMKDILAKAGGNVKKTEQSAAQQRRSYHTSN
FTRRLDFSARPSIVPQQRRTLHLTRDQSTNLLKEYKMNLTVPPEGSPSTHYLGISPNRSA
RSPSIIASPTANASTLNQRVRRFPFDYRAGPSSETIQAAIAHMQLDAAPPKAKAQTVELI
KNLWKLYKEKEAIDTHVKLALSVESDEMLVYEPYLFFDDAAFKSGKRQADLHTLRDQASV
SATDREAEEAGIVYIPLGSPEFPAGTTQAGTQTPPSSTTEEGPRNLIGTLVNGAGLALNT
VDTLSLRLSQPPYSTSAANFLDTGGKATSATIKTSFKLILSDPRVSVVFVNIFGGLTLCD
MIAEGIIMAFKEIGVEKPVVVRLRGTNEEKGQKVLEEAKLPIHAFDDFEEAVRKVGELAN
ARGL
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgctttcacagcaagtgcgtatcttgcgcaataacgtccgcacggcgcaaaagccctgc
cgaaggacaccttgtgccaccttctcggtctcctctcgacgcaacaactacgatgacacc
attcaaaatctcaaaatcggttcgcacacacgcgtgatattccaaggatttaccggaaaa
caagccactgcgaatgcaagagagtcgatagaatgggggaccaatgtggttggcggtgtg
aaacccaacggctcaggagagcatcttgggctgcctgtattgccgtctgtgagggccgcc
atggaacaattgaagccagatgccacgggaatctatgtggcagctcatcaggcgacagct
gcaattgaagaggccattgaagccgaggtgccactcatcgttgcagttgcggaacacatt
ccattgcatgatatgatgaggatacattcgatgctgcagtcgcagtccaagtcgcggctc
gtgggtgccaatgcccctggtatcatctctgctattgggaaatgcaggatcgggttccaa
ccactcccaacgttctctcctgggcacatcggcattgtagcaaaatctggcacgctctca
tacgagaccgtaggatctctaacgcgagctggtgttggtcagagtctatgcatcgcagta
ggaggtgacgtgatcgctgggaccaactttgtcgatgccttgaaagtttttgagcatgac
gaagataccaaagctatcatcatcgtcggcgaactaggcggtacaacagaagaggaggcg
gcggactggatcaatgactacaagaggcgtgtcaagaatccgaaacctattgccgctgtg
attgggggattcgaagcgccgcacggaaaggtaatgggtcatgcaggcgcgtgggtcggt
ctgggagaaggcactgcggcttcaaagtacaaggcgcttgaaaatgccggtgtaactatg
gtggatcatcctgctaaatttggcggtgtgatgaaggatattcttgcaaaggccggtggc
aatgtgaagaaaactgaacaatccgccgctcaacaacgccgctcatatcatacttcaaac
ttcacacggagacttgacttttccgctagaccgtcaatcgtgcctcaacaaagacgtact
ctccatctcacccgagaccaatctacaaacctcctcaaagaatacaagatgaacttaact
gtaccacctgagggctcaccgtcaacacattacctaggaatctcccccaatcgctcagcc
cgcagtccttcaatcatcgcatcacccaccgcaaatgcttccacactcaaccaacgcgtc
cgtcgctttcccttcgactaccgtgcaggccccagttcagagaccatccaagccgcaatc
gcacacatgcaactcgacgctgcaccacctaaagctaaagcccaaacagtcgaattgatt
aagaatctctggaagctatacaaagagaaggaagccatagacacccatgtcaagctcgct
ctgtctgtagagagcgacgagatgcttgtctacgaaccatacctgttcttcgacgacgca
gcgttcaagtcaggaaaacgacaagctgatcttcacactctacgcgatcaagcctccgtt
tcagctacagatcgggaagcagaagaagcgggtattgtttacatacccttgggctctcct
gaatttcctgctggcactactcaggcagggactcaaacgccaccgtcctctactaccgag
gaaggaccgcgaaatctgattggtactctggtcaacggtgctggactcgcgttaaacacg
gttgatacgctttctctgcgtctttctcaaccgccttactcgacttctgctgccaacttc
ctcgacacgggtggcaaggcgacgtccgccactatcaagacctcgtttaagctcatccta
tctgatccccgcgtttccgtcgtctttgtaaacatctttggaggactgacgttgtgcgac
atgatcgccgagggaatcataatggctttcaaggagattggagtagagaaaccagtcgtc
gttagattgaggggaacaaatgaagagaaaggacaaaaggtgctggaagaagctaaactg
cccattcatgcatttgacgactttgaagaggcagtcaggaaggttggagaactggctaat
gctagaggattgtaa

DBGET integrated database retrieval system