KEGG   Apteryx mantelli mantelli (brown kiwi): 106482194Help
Entry
106482194         CDS       T04298                                 

Gene name
CPT1A
Definition
(RefSeq) carnitine palmitoyltransferase 1A
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
aam  Apteryx mantelli mantelli (brown kiwi)
Pathway
aam00071  Fatty acid degradation
aam01212  Fatty acid metabolism
aam03320  PPAR signaling pathway
aam04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:aam00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106482194 (CPT1A)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    106482194 (CPT1A)
   03320 PPAR signaling pathway
    106482194 (CPT1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aam03029]
    106482194 (CPT1A)
Enzymes [BR:aam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     106482194 (CPT1A)
Mitochondrial biogenesis [BR:aam03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    106482194 (CPT1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 106482194
NCBI-ProteinID: XP_013795181
Position
Un
AA seq 769 aa AA seqDB search
MAEAHQAVAFQFTVTPDGIDLRMSHEALKQIYLSGVHSWKKKFIRFKNGIITGVYPASPS
SWLIVVVGVMSTMYAKIDPSLGIIAKINRTLDTTGYMSNQTQNIVSGILFGTGLWVALIV
TMRYSLKMLLSYHGWMFAEHGKLSAGTRFWMALVKLFSGHKPMLYSFQTSLPRLPVPSVK
DTVNRYLESVRPLMNDGEFRRMEGLAKDFAFNLGPRLQWYLKLKSWWATNYVSDWWEEYI
YLRGRGPIMVNSNYFAMDFLYLAPTTLQAARAGNVIHAILLYRKKLDRQEIKPILLLGST
VPLCSAQWERMFNTSRIPGEETDTLQHVKDSKHIVVYHKGRYFKVWLYHDGRLLKPREIE
QQMQRILDDTSEPQAGEQKLAALTAGDRVPWAKARQAYFSRGKNKQSLDAIEKAAFFVTL
DDIEQGYRKEDPVTSLDMYAKSLIHGRCYDRWFDKTFTLVVFKNGRIGLNAEHSWADAPI
VGHLWENVMTTEYLELGYSEDGHCRGDSNQNIPIPTKLQWEIPEECQEVIERSLSTATAL
ADDVDFHSFFFDAFGKGLIKKAKISPDAFVQLALQLAHYRDMGKFSLTYEASMTRLFREG
RTETVRSCTVESCNFVRAMEDPTESNENKLKLLRVATAKHQLLYRLAMTGAGIDRHLFCL
YVVSKYLAVDSPFLKEVLSEPWRLSTSQTPQQHIDLKKNPEMLSCGGGFGPVADDGYGVS
YIILDENSIHFHVSSKISCSETDSHRFGKNIRQAMVEIMALFSLKNCTK
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagcccatcaagcggtagcatttcaatttacagtaactccagatgggatcgac
ctgcgcatgagccatgaggcactcaaacaaatatacctatctggtgtccattcctggaag
aaaaagttcatcagattcaagaatggaattatcacaggcgtttatcctgctagcccatct
agctggcttattgtagttgtgggtgtgatgtcaacaatgtatgccaaaattgatccttct
ttaggaataatagctaaaatcaaccgaacccttgatacaacaggctatatgtcgaaccaa
acgcagaatatcgtgagcggaatactttttggcacagggctttgggtggcccttattgtc
acaatgcgctactctctaaaaatgctgctttcttatcacggttggatgttcgccgaacat
ggcaaactttctgcaggcaccagattctggatggcactcgtgaaactcttctcaggacat
aagcccatgttatacagcttccagacatctttaccacggttgccggttccatccgtgaaa
gacacagtcaataggtatctggaatcagttcggccgcttatgaatgatggagagttcaga
agaatggagggtctggccaaagattttgcatttaatttgggaccaaggcttcagtggtat
ttgaagctaaaatcttggtgggccacaaactatgttagtgattggtgggaagaatatatc
taccttagaggacgtggaccaattatggttaatagtaactattttgcaatggacttcctt
tatttagctcccactaccctgcaggcagctagagctggtaatgttatccatgccatcctg
ctctacaggaagaaactggacagacaagaaatcaagccaattcttctgctgggatctact
gttccactctgctcagctcagtgggagcggatgtttaatacctcccgtatcccgggagag
gaaacagatactctccagcatgtgaaagacagcaaacacattgtagtgtatcataagggg
cgttacttcaaagtgtggctgtaccacgatggtagactgctgaaaccccgagaaatcgaa
cagcagatgcaaagaattcttgacgacacttcagagcctcaggctggggagcagaagcta
gcagctctcactgcaggagatagagtaccatgggctaaagctcggcaggcttattttagc
cgtggaaagaacaagcagtccctagatgccattgaaaaagcagcattttttgtgacactg
gatgacatcgagcaagggtacaggaaggaagacccggtgacatcactggatatgtatgca
aagtccctaatacatggcagatgttatgacaggtggtttgataaaacattcactcttgtt
gtgttcaagaatggcagaattggcctgaatgcagagcactcttgggcagatgctcctatt
gtcggacacctttgggagaacgtaatgacaacagagtatcttgaactgggctattcggaa
gatggacattgcagaggagatagcaatcaaaatattcctattcctaccaaactacagtgg
gagattccagaagaatgccaagaagtgattgagaggtctctgagcactgccacagctctg
gcagatgatgtagacttccattcatttttctttgatgcctttgggaaggggctaatcaag
aaagcaaaaatcagccctgatgcctttgtgcaacttgccctgcagcttgctcactatcgg
gacatgggaaaattttctttaacgtatgaagcctcgatgacccgcttgttcagagaaggc
aggactgaaactgttcgctcatgtactgttgaatcctgtaattttgttcgagccatggaa
gacccaactgaaagcaatgaaaacaagctcaagctcttgagggtcgctactgccaaacat
cagcttttatatcgtcttgccatgaccggtgctggcattgaccgtcatctgttctgcctt
tatgtggtgtccaaataccttgctgttgattctccttttcttaaggaagttttgtcggag
ccttggagactgtcgacgagtcagacaccacaacaacacattgatctaaagaagaaccct
gagatgttatcctgtggtggaggatttgggccggtggctgatgatggttatggtgtctct
tacattatcttggatgaaaattccatccacttccatgtctccagcaaaatctcgtgttct
gagacggattctcatcgttttggaaaaaacatccgacaagcaatggttgaaatcatggct
ttatttagccttaaaaactgtaccaagtga

DBGET integrated database retrieval system