KEGG   Apteryx australis mantelli (brown kiwi): 106483274Help
Entry
106483274         CDS       T04298                                 

Definition
(RefSeq) arylamine N-acetyltransferase, liver isozyme-like
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam00232  Caffeine metabolism
aam00983  Drug metabolism - other enzymes
aam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aam00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    106483274
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    106483274
Enzymes [BR:aam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     106483274
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 106483274
NCBI-ProteinID: XP_013796638
Position
Un
AA seq 295 aa AA seqDB search
MNIQEYFSRISYRGSHKDADLKTLTGILQHHVQAIPFENLSMHCGESIDLDLEPIYNKIV
RKKRGGWCLENNYLLFWALQGIGYDVTILGGNSYDPAERTYTADINHVLLKVVIDGKSYI
VDSGFGGTYQMWQPMMLISGKDQPQIPGIFRFTEDNGIWYFEKIKRKHYIPEQSVPSTDI
PETGEIRKIYSFTLEPRHMSDFQELNMYLQTSPDTLFQKKSICTLQTTEGVRALVGWTFT
ELKYNYMEDMDLVKITTLSDEEVEKTLKDKFSITLENKLIPVNVRGLPPNLVDMI
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcaagaatatttctcaagaatttcttatcgtgggtcccataaagatgcagac
ttgaaaaccttaacaggcatcttgcagcaccatgtccaggcgatcccttttgaaaacctc
agcatgcactgtggggagagcattgatctggatttagaacctatttacaacaagattgtg
agaaagaaacgtggtggatggtgcctggaaaacaactaccttttattttgggctttgcaa
ggaatagggtatgacgtcactattcttggaggcaatagttacgatccagcagagagaaca
tacactgctgacataaatcatgtcctactgaaggtggtgatcgatggcaaatcctacatc
gtagacagcggttttggtggtacctatcaaatgtggcagccaatgatgctgatttctggg
aaggatcaacctcagattcctggcatctttcgcttcacggaggacaatggtatctggtac
tttgagaaaataaaaaggaagcattatattccagagcaaagcgtcccttcaactgatatt
ccagaaacgggggagatcagaaaaatatattcattcactcttgagccacgacatatgagt
gacttccaggagctaaacatgtacctacagacatctccggataccttatttcagaaaaag
tcaatctgcactctccagaccactgaaggggttcgtgccttagttggatggaccttcact
gagctgaagtacaactacatggaggacatggacctggtgaagatcacaactctttcagat
gaagaggttgagaagaccctgaaagataaattcagtataaccttagagaacaaactcata
ccagtaaatgttcgtggcttgccacctaatttagtggatatgatctaa

DBGET integrated database retrieval system