KEGG   Apteryx australis mantelli (brown kiwi): 106483368Help
Entry
106483368         CDS       T04298                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:aam00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106483368
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:aam04030]
    106483368
G protein-coupled receptors [BR:aam04030]
 Rhodopsin family
  Lipid
   Leukotriene
    106483368
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx His_kinase
Motif
Other DBs
NCBI-GeneID: 106483368
NCBI-ProteinID: XP_013796723
Position
Un
AA seq 336 aa AA seqDB search
MTQTEENSSYLTWHIERSVVCIILSLSFIIGTPGNCIVIWTVCTKMKQVSPSVLLILNLA
IADILVLITLPIWIYSFADSWVFGVIFCKILVFLIYCSMYASIFLITALSLERLMAVFYP
FTIQRYKTKEKIFVIMFLIWFLSITFGISVIPFQETEEMSGGLQCTCRNYSSNRQKVSYL
LLETLAGFVIPFFIICTCYVCVGKRISKMTYQSKRRSERLIASVVVAFILCWLPHHLFNI
LEIISVQIEHSNKKMSLALDEILNIGVYISGALVFISSCINPLLYAFAARRFQNHLRFAK
ISKLFEQMSQTVTEEDKKKNSVITKQEDTAISTENL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgactcagactgaggaaaacagtagctacttgacatggcacattgagaggtcagtagtc
tgcataatactgagcttgtcatttattattgggacccctggaaactgcattgtcatctgg
actgtttgtacaaaaatgaagcaagtatctccttcagtgctgctgatcttgaacctggcc
attgcagatatccttgtactgattactttgccaatctggatttactcctttgctgactcc
tgggtttttggagtcatcttctgcaaaatactggttttccttatttactgcagcatgtat
gctagtatatttctaattacagcactgagcttggagagattaatggctgtgttttaccca
ttcacgattcaaagatataaaacaaaagaaaaaatttttgtaatcatgttcctcatttgg
ttcctgtctattacttttggcatttctgtcattccgtttcaagagacagaagaaatgagt
ggtggactacaatgcacatgtcgcaactactcttctaatagacagaaagtatcttatctt
ttgctagagactcttgcaggttttgtaattcctttttttataatttgcacttgttatgtg
tgtgttggaaaaagaataagcaaaatgacttaccaatcaaagcgacgatcagaacggcta
attgccagcgtggttgtagcattcattttatgctggctcccacatcatctctttaacatc
ctagagattatttcagtacagatagaacactctaacaaaaaaatgtctttggcactggat
gaaattttaaacataggagtgtacatctctggagcacttgtattcatcagtagctgtatt
aaccctctactttatgcctttgctgcacgaagatttcagaatcacctgagatttgccaag
atatcgaagctgtttgaacagatgagtcagactgtaacagaggaagacaagaagaagaac
tctgttataaccaaacaagaagatactgcaataagcacagagaatctttaa

DBGET integrated database retrieval system