KEGG   Apteryx mantelli mantelli (brown kiwi): 106483751
Entry
106483751         CDS       T04298                                 

Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13-like
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
aam  Apteryx mantelli mantelli (brown kiwi)
Brite
KEGG Orthology (KO) [BR:aam00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aam01002]
    106483751
Enzymes [BR:aam01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     106483751
Peptidases and inhibitors [BR:aam01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   106483751
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_4 TSP1_spondin ADAM_spacer1 Reprolysin_5 Reprolysin_3 TSP1_CCN Reprolysin_2 Peptidase_M10 CUB Peptidase_M66
Other DBs
NCBI-GeneID: 106483751
NCBI-ProteinID: XP_013797211
Position
Un
AA seq 1465 aa
MIISLMIRVLMMFPLGFCWPPVFQEKFLRALDPEDVFSYFGTSSVSDVPEFVVAQPTCPC
KEEQIGLASCRIQHCSIEAWGQLYAFEFLEDHALLSSSFVSNHMLNSSFSLLKRFSGNCF
AGGNPLQPPGAKCRVTYCEGRLQGVIIADEEKIRIRPVRSKDIVLLKDLGFSRPHIIFRS
AGRGASTARGQSPPRLQKRAEGTVKHLELMVVAGPDVYLHHKEDTERYILANLNIGAELL
RDTSLGAHFRVHLMQMIVLREPEMDVNITTNITSSLISVCEWSKKVNPQNDSDPQHADIV
LYVTRFDLELPDGNKELRGVTHLGGVCSSFWSCVITQDTGFDLGVTIAHEIGHSLGIPHD
GEGNRCSSTGYIMGSAGNHNSIDLSWSQCSQEEFLAFVSTGQTNCLNDLPDMDGSIPGWK
PGLYYGADEQCKIAFGNVATACTFADSNVDICKVLSCHVQPEDKSTCTRLLVPLLDGTEC
GINKWCSKGRCSSLEELNPMAVVHGQWSSWSPFSSCSRSCGGGVVIRQRFCNNPRPAFGG
QECRGAGIQAEMCNTQACPMSQLDFMAEQCAATNSKPLDLTVEVPSFYTWTSAVGFAKGD
LLCKHMCRAVGKEFMVSREDSFIDGTRCEQDNSERHGAFHLCVMGSCKAFGCDGQMDSRK
TMDSCKVCGGDNTTCTKVSGSYTEGKAKEYVTFLSLPYNTTFVRVINWRPLFTHLAVKVK
GEYVVAGKGKISLNVTYPSVLEDSQIKYKVFLTKDNLPSLEEVHVDGPTQEEIEIQVYRR
YAKEYGSATNPYITFSYFVPKENLTYVWIPQKGQCSVTCGEGTRLVDHVCFDQTKNETTE
DQQCLGLPQPLSEQEPCTMGPCLYRWKKSEIDECSAVCGTGVAQQNLTCVQSRDGLETVV
DDSLCAAEEKPLSIVPCVVNVCPLGWDKEEDTHLLQTAESFGHIQLENQPVYVWSPLAGE
CSVSCGKGKTQLQYVCVAFDTKEETQEENCHAVPKPESRMEVCNLNPCPPRWHYKMGSCS
VSCGGGVMHKVLYCARETGEKAEEIVADTQCDGLPRPEEQEPCNLEPCPPRWKVAPAGPC
SSTCGLGLAVQLVTCVQIHQGQEMLLEDHLCPVVEKPLTSIPCVIRMCSYEWGFSEWTEC
STSCGNGVQTRQDFCLNTLTRKHVNPIFCRHFPKSIVLRGCSAGPCPEQAVAARSRGAEF
HAVTPATHPATAVTAKWARYKGLDLPPSAVPTLPQEPTEETGGGVCGRLFLNATGVINMM
GAESSDCAVTIGRPLGEEITVSVLESSLNCSAGELLQFSGRIMWWKGCRKLPLSLINSRT
NTLVVKQRVLMPGNGVILQYGSRAATKKYYQDCDKQLFGPQGEIVYPVQLPDQRQEVVCR
TFIDVAPQHRIAIRALYIDLGNDSNQTQSNYILIRDVSTMKMMVFHGKQQFFWESTGSQA
EIEFHENVKEHRTSFWAEYCIAEPK
NT seq 4398 nt   +upstreamnt  +downstreamnt
atgatcatcagcttgatgatccgagtgctcatgatgttcccgctgggattttgctggccg
ccggttttccaagagaaatttctcagagctttggatccagaagatgttttctcctatttt
ggcaccagctcagtttctgatgtacctgagtttgttgtcgctcagccaacttgcccttgt
aaagaagagcagattggactggcgtcatgtcggattcaacactgctccattgaggcctgg
ggacaactctatgcctttgagttcctagaggaccatgccctcctgtcctcttcctttgtg
agcaatcacatgctgaactcttcctttagcttactgaagcgattctcaggcaactgcttt
gcaggtggaaatccactgcaacctccaggggctaagtgtagagtcacttactgtgaaggg
cggctgcaaggggtcatcattgcagatgaggaaaagattcgtatcagacctgtcagaagc
aaagatattgtcctgctgaaggaccttggcttctccagaccccacattatcttcagaagt
gctggaagaggggcaagtacagcaagagggcagtctcctcctcgcctgcagaagagggct
gagggaactgtcaaacatctggagctgatggttgtagcaggtcctgatgtttacttgcac
cacaaagaggacacggagcgatacattcttgctaacctgaacattggagcagagctgctg
agagatacttcactgggtgctcatttcagggttcacctgatgcaaatgattgttttgaga
gaaccagagatggacgtaaacatcacaacaaatatcacctcctcgctgatcagtgtatgt
gaatggagcaagaaagtcaacccccagaatgactctgatccccagcatgctgacattgtc
ctgtatgtgaccaggtttgacctggagttacctgatgggaacaaggagctacgtggagtg
acccatttagggggagtctgttcctccttctggagctgtgttattacccaggacacaggc
tttgacctgggagtcaccatagcccatgagattgggcacagtcttggaatcccccacgat
ggtgaggggaatcgctgcagtagcaccggttacatcatgggttcagcaggaaaccacaac
agtattgacctttcctggtcacagtgtagccaggaagagttcctggcctttgtcagcaca
ggccaaacaaactgcttaaatgacctgccggacatggacggcagcatccctgggtggaag
cctggcttatactatggagcagatgaacaatgtaaaatagcctttgggaatgtcgccaca
gcgtgcacctttgctgacagcaacgttgatatatgtaaggttctctcatgccatgtacaa
ccagaagacaaatccacctgcactcggcttcttgttcccctcttggatggtactgagtgt
ggaatcaataagtggtgctccaagggacggtgcagctctctggaagaactgaaccccatg
gccgtagtgcatgggcagtggtccagctggagccccttctcctcctgctctcgcagctgt
ggaggcggagttgtgatcaggcagcggttctgcaacaaccccaggcctgcttttgggggg
caagagtgccgaggagctggcatccaagcagagatgtgcaatacccaggcctgtccgatg
agccagctggactttatggctgaacaatgcgcagcaacaaattcaaagccactggatctc
actgtagaagtgccatccttttatacctggacttctgctgttggctttgccaaaggggac
ttgctatgcaagcacatgtgcagagcagttggaaaagaattcatggtaagccgtgaagat
agtttcatagatggaaccagatgcgagcaggataactctgaacgccatggggctttccat
ctctgtgtaatgggaagctgcaaagcattcgggtgtgatggtcagatggactccaggaag
acaatggactcttgtaaggtctgtgggggtgataataccacatgcaccaaagtgagtgga
tcttacacagaaggaaaagctaaagagtacgttacatttctgtccctgccttataacact
acctttgtccgtgttatcaattggagaccgctcttcacacatttggctgtgaaagttaaa
ggtgagtatgtggttgctggaaagggaaaaatctcattgaatgtcacctatccatctgtt
ctggaggacagccagatcaaatataaggtgtttctcacaaaggacaacttgccaagcctg
gaggaagtccatgtggatgggccaacccaagaggaaattgagatacaggtctatagaagg
tatgcaaaagaatacggcagtgccaccaacccgtacatcactttcagctactttgtgccg
aaagagaatctgacatatgtgtggattcctcagaaggggcaatgctcagtgacctgtggg
gaagggactcgcctggtggatcacgtgtgcttcgaccagacaaagaatgaaacaacagag
gatcagcagtgtctgggcctcccgcagcccctttcagagcaggagccctgtaccatggga
ccatgtctgtacaggtggaagaaatctgaaatagatgaatgctctgctgtctgtggaact
ggagttgcccagcagaatctgacctgtgttcagtctcgtgatggattggagactgttgtg
gatgacagcttgtgtgcagcagaagaaaaacccctctccattgtgccgtgtgtggttaat
gtctgccctttaggctgggacaaagaggaagacacacacttgctgcagactgcggagtca
tttggacatatccaactggaaaatcagcctgtgtatgtctggagccctctggctggagag
tgttctgtctcctgtggtaaaggtaaaactcagctacaatatgtatgtgtggcttttgac
accaaagaagaaacccaggaagaaaattgtcacgcagtgccaaagcctgagagcaggatg
gaagtttgcaatctcaatccctgcccaccgaggtggcattacaaaatgggctcgtgcagt
gtaagctgtggaggaggtgtgatgcacaaggtcctctactgtgcaagggagaccggggag
aaggcagaagagattgtagcagatacccagtgcgatggtttgcctcgcccagaggaacag
gagccgtgtaatttggagccatgccctccaagatggaaggtagccccagctggcccctgt
tcctccacctgtgggcttggcttagctgttcagctggtcacctgtgttcagatccaccaa
ggccaagagatgttgttggaggaccacttatgtcctgtggtagagaagccccttaccagc
atcccctgtgtcatccgaatgtgctcttatgaatggggcttcagcgaatggacggagtgc
tcaacttcatgtgggaatggtgttcagacacgtcaggatttctgcctcaacacgctaacc
cgtaagcacgtgaaccccatcttctgcaggcacttccccaagtccattgtgctacgtggc
tgctccgcagggccctgccctgagcaggcagtggcggccaggtcccgtggagcagagttc
catgcagtgacaccagccacgcatccggcgacagccgtaactgccaaatgggcaagatat
aagggcctggatcttcctccatctgctgtgccaactcttcctcaggaaccgacagaggag
acgggtggaggtgtctgtgggaggctctttcttaatgccaccggggtcatcaacatgatg
ggtgcagagagcagtgactgcgctgtgaccattggacgccctctcggggaggagataaca
gtcagcgttctggagagctccctcaactgcagtgcaggtgagctactgcagttttctggg
cgaataatgtggtggaagggctgcaggaagctccctttgtcactgataaattccagaacg
aatacactggttgtgaaacagcgtgttttgatgccagggaacggggtcattcttcagtac
ggcagcagagcggcaactaaaaaatattaccaagactgtgacaagcagctgtttggtccc
caaggtgaaatagtgtatcctgtgcaattgcctgatcaaaggcaagaagtagtgtgtcgg
accttcatcgatgtggctcctcagcatcgcatagccatccgcgccctgtatattgacctg
ggcaatgacagcaaccaaacacagtctaattacatcctgatccgtgatgtaagcaccatg
aagatgatggtgtttcatgggaaacaacaattcttctgggaatcaactggaagccaagct
gaaattgaatttcatgaaaatgttaaggaacatcgaaccagtttctgggctgaatattgc
attgctgagcccaaataa

DBGET integrated database retrieval system