KEGG   Apteryx mantelli mantelli (brown kiwi): 106484111
Entry
106484111         CDS       T04298                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
aam  Apteryx mantelli mantelli (brown kiwi)
Pathway
aam04080  Neuroactive ligand-receptor interaction
aam04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:aam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106484111 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106484111 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 106484111
NCBI-ProteinID: XP_013797690
Position
Un
AA seq 61 aa
LFLPSSGPLGQAPDGKDPEEGLIRNLVQPRGVRRGAGHRPGGWRRYRRPRPRLSHKGPMP
F
NT seq 186 nt   +upstreamnt  +downstreamnt
ctcttcttgccatcctcagggccgctgggtcaggcaccagatgggaaggatccagaggag
ggcctcatccgaaacttggtgcagccgcggggtgtgcggcgcggagctggccatcggccg
ggtggctggcggaggtaccgcagaccccggccccggctctcccacaagggccccatgccc
ttctga

DBGET integrated database retrieval system