KEGG   Apteryx mantelli mantelli (brown kiwi): 106484471Help
Entry
106484471         CDS       T04298                                 

Gene name
ATG16L1
Definition
(RefSeq) autophagy related 16 like 1
Organism
aam  Apteryx mantelli mantelli (brown kiwi)
Pathway
aam04136  Autophagy - other
aam04140  Autophagy - animal
aam04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:aam00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106484471 (ATG16L1)
   04136 Autophagy - other
    106484471 (ATG16L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    106484471 (ATG16L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A Ge1_WD40 Nup160 ERM ZapB Fez1 KASH_CCD V_ATPase_I SGL HTH_6 Lipoprotein_6 WD40_like YabA YicC_N
Motif
Other DBs
NCBI-GeneID: 106484471
NCBI-ProteinID: XP_013798125
Position
Un
AA seq 546 aa AA seqDB search
MQSRHEISPGHDGTWNDAQLQELAQLKIKHQEELTELHKKRGELAQSVIDLNNQMQQKDK
EMQMNEAKIAEYLQKISELETECQELRSKLQDLERANQTLKDEYDALQITFNALEEKLRK
TTEDNQELVSRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEPRDDDIE
VLADETSDTAEETSPVRTVSRTSSKRLSQPAGSLLDSITNIFGRRSLSSFPAPQDNAEPH
PGSSKEVRVPNTAICVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVLGDRCEPKGS
LSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDNRLRHTLTGHSGKVLSAKFLLDNA
RIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRTESI
VKELELFGRITALDLNSERTELLTCSRDDLLKIIDLRVSAVKQTFSAQGFKCGSDWTRVV
FSPDGNYVAAGSADGALYVWNVLTGKLERTLAKHHSSPINAVAWSPAGAHVVSVDKGNKA
VLWSEF
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagcagacatgagatcagtccaggacatgatggcacatggaatgatgctcagttg
caggagctggcccagctgaagataaagcatcaagaggagctgacagagctgcataagaaa
cgtggcgagttggcccagtctgtaattgatctgaataaccaaatgcagcagaaagacaaa
gagatgcagatgaatgaagctaagattgcagaatatttgcaaaagatctccgagctggaa
acagagtgccaggaattgcgtagcaagctgcaagatcttgagcgagctaatcagacactg
aaagatgaatatgacgctctccagatcaccttcaatgccttggaagaaaaactgaggaaa
actactgaagataaccaggagctggtctcacgttggatggcagagaaggcacaagaagcc
aatcgtttgaatgcagaaaacgaaaaggattcaaggagacgacaagccaggctgcagaag
gagctagcagaagctgccaaagaaccactgcctgttgaacccagggatgacgatattgaa
gtgcttgcagatgaaacctctgacacagccgaggaaacgtctccggtgcgaactgtcagc
cggacatccagtaagcgactctcccagccagctggaagccttctggactctatcactaat
atctttgggagacgttctttgtcctcgttccctgctccccaggataatgcagagccacat
ccaggttccagtaaagaagtgagggtgcccaatactgccatatgtgtctttgacgcacat
gatggggaggtgaacgcagtgcagttcagccctggctcccggttactagcaacaggaggc
atggaccggagggttaagctttgggaagtcttgggagataggtgtgagcccaaaggttcc
ctctctggtagtaatgctgggattacaagcatagaatttgatagtgctggttcttacctc
ttagcagcttcaaatgattttgccagcagaatctggacggtcgatgacaatcgattacgg
cacaccctgacaggtcacagcggtaaagttctgtcagccaagttcttgttggacaatgcg
cgcattgtttcgggaagtcatgaccggaccctcaagctttgggacctccgcagcaaagtt
tgtataaaaacagtgtttgcaggatctagctgcaatgacatcgtatgtactgagcagtgt
gtaatgagtggacattttgataagaaaattcgtttctgggacatcaggactgaaagcata
gtaaaagaactagaactgtttgggaggatcacagctctagacctgaactcagagcgaaca
gagcttctgacctgttcccgtgatgatctactgaagatcattgatctacgggtcagtgct
gtcaagcagacattcagtgcccaaggatttaaatgtggatctgactggacaagagttgtg
ttcagccctgatggtaactatgtggctgctggttcagctgatggggccctctatgtctgg
aatgtgctcactgggaaattggagaggacgcttgcaaagcatcacagttctcctatcaat
gccgtcgcatggtcgccagcaggtgcccatgtggtcagtgtggacaaaggaaacaaggct
gtcctgtggtctgaattctga

DBGET integrated database retrieval system