KEGG   Apteryx australis mantelli (brown kiwi): 106485035Help
Entry
106485035         CDS       T04298                                 

Definition
(RefSeq) band 3 anion transport protein-like
  KO
K06573  solute carrier family 4 (anion exchanger), member 1
Organism
aam  Apteryx australis mantelli (brown kiwi)
Brite
KEGG Orthology (KO) [BR:aam00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aam02000]
    106485035
   04147 Exosome [BR:aam04147]
    106485035
   04090 CD molecules [BR:aam04090]
    106485035
Transporters [BR:aam02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   106485035
Exosome [BR:aam04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106485035
CD molecules [BR:aam04090]
 Proteins
  106485035
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto PTS_EIIA_2 Comm
Motif
Other DBs
NCBI-GeneID: 106485035
NCBI-ProteinID: XP_013798789
Position
Un
AA seq 1057 aa AA seqDB search
MERPGQEAYEDVMRKNLDPEGYEDPGVHSSRISLGEMSNPPVTAAVPAGAVLLDVAATSL
PGIAHVLIDQMIYEGQIKPQDREAILRTLLLQHKYGPCPHDSLSLCPCACVSPPSHFHVP
PHPCAPSSLCPSDLMSGPHFPMPPSPCIPVSRCPYAPVLLCPRVPVSPHVPMPTSPCPSD
PMPQCPCVLVSLYPHVPILCVPPHVPMPCVPMSCARSPRDPIPSHPVLPPGCAAFLEQPT
LAFVRLKNAVMLDAVLEVPLPVRFLFVVLGPDSPHVSYHEIGRAVATMMSDRVRLHRAPA
PAHPTDPLPEPIPLGPWPHGPIAPGLHVPMHPCPRDSVAPGHHVPMHMWSHVPXVRGQGS
VQHRRAGGCAAFLEQPTLAFVRLKNAVMLDAVLEVPLPVRFLFVVLGPDSPHVSYHEIGR
AVATMMSDRAGDTEGGRGPANAAVAPLAAPSVTDVDLEAAGSRRRVSRRDTHEVGCAAFL
EQPTLAFVRLKNAVMLDAVLEVPLPVRFLFVVLGPDSPHVSYHEIGRAVATMMSDRHYLS
DFRDALNAQCIAAVIFIYFAALSPAVTFGGLLNEKTKGMMGVSELLIATCVQCVLFSLLS
AQPLLVVGFSGPLLVFEESFYTFCESNDMEYIVGRVWIGFWLILLVLVVVACEGSVLVRY
LSRYTQEIFSFLISLIFIYETFDKLFKIFKAHPLQRVYNVTPTLNPLVTPTEEPNTALLS
LVLMAGTFFLALFLRKFKNSAFLPGKVRRLVGDFGVPISIFIMAMIDFFIKDTYTQKLKV
PKGLEVTNASARGWFISPMGNKKTFPIWMMFASVVPALLVFILIFLETQITTLIVSKPER
KLVKGSGFHLDLLLIVGMGGVAALFGMPWLSATTVRTITHANALTVMSKSSSPSEKSQIL
EVKEQRISGLLVAVLIGVSIFMEPILKYIPLAVLFGIFLYMGVTSLFGIQLFDRILLMLM
PPKYHPKEPYVTRVKTWRMHLFTFTQIITLAVLWAVKSTPASLALPFVLILTVPVRRFLL
PRIFRDVELRCLDADSAAVTLDEVEGKDVYDEVQMPS
NT seq 3174 nt NT seq  +upstreamnt  +downstreamnt
atggagaggccaggccaggaggcctacgaggacgtgatgaggaaaaacctggaccccgag
ggctacgaagaccccggtgtgcacagctcgcgcatctcgctgggggagatgagcaacccg
ccggtgaccgctgctgtccctgcaggcgccgtcctcctcgacgtggcggcgacctcgctg
ccgggcatcgcccacgtgctcatcgaccagatgatctacgaggggcagatcaagccgcag
gaccgcgaggccatcctgaggaccctgctgctgcagcacaagtacggcccctgtccccac
gactccttgtccctgtgtccctgtgcctgcgtgtctccaccttcccatttccacgtgccc
ccacatccctgtgccccttcgtccttgtgtccctctgacctcatgtctggtccccatttc
cccatgcccccaagtccctgcatccctgtgtcccggtgtccttatgcccctgtgctgctg
tgtccccgtgtccctgtgtccccccatgtccccatgcccacatctccatgtccttctgac
cccatgccccaatgtccctgtgtccttgtgtctctgtacccccatgtccccatcctctgt
gtccccccccatgtccccatgccctgtgtccccatgtcctgtgcccggtcccctcgtgac
cccatcccgtcccatcccgtcctcccaccaggctgcgcggccttcctggagcagccgacg
ctggccttcgtgcgcctgaagaacgctgtgatgctggacgccgtcctcgaagtgccgctg
cccgtgcgcttcctcttcgtggtgctgggccccgacagcccccacgtcagctaccacgag
atcggccgcgccgtggccaccatgatgtccgaccgggtacggctccaccgggcaccagcc
cctgcgcaccccacggaccctctgccggagcccatccctctgggcccatggccccatggc
cccatagccccaggtctccacgtccccatgcacccatgtccccgtgactctgtggcccca
ggccaccacgtccccatgcacatgtggtcccatgtccccatngtgcgggggcaaggcagc
gtccagcaccgcagggcagggggctgcgcggccttcctggagcagccgacgctggccttc
gtgcgcctgaagaacgctgtgatgctggacgccgtcctcgaagtgccgctgcccgtgcgc
ttcctcttcgtggtgctgggccccgacagcccccacgtcagctaccacgagatcggccgc
gccgtggccaccatgatgtccgaccgggcaggggacacagagggcggccgtgggccagct
aacgcggccgtcgctccgctcgcagctccgtcggtgaccgatgtggacctggaggcggcg
gggagcaggaggcgcgtgtcccggcgggacacccatgaggtgggctgcgcggccttcctg
gagcagccgacgctggccttcgtgcgcctgaagaacgctgtgatgctggacgccgtcctc
gaagtgccgctgcccgtgcgcttcctcttcgtggtgctgggccccgacagcccccacgtc
agctaccacgagatcggccgcgccgtggccaccatgatgtccgaccggcactacctgagc
gacttccgggacgcgctcaacgcccagtgcatcgccgccgtcatcttcatctacttcgcc
gcgctgtcgcccgccgtcaccttcggaggcctgctgaatgagaagaccaagggcatgatg
ggggtgtcggagctgctcatcgccacgtgcgtgcagtgcgtcctcttcagcctgctcagc
gcccagcccctgctcgtcgtcggcttctcggggcccctgctcgtcttcgaggagtccttc
tacacgttctgcgagagcaacgacatggagtacatcgtgggccgcgtctggatcggcttc
tggctcatcctgctggtgctggtggtggtggcctgcgagggcagcgtcctggtgcgctac
ctctcccgctacacccaggagatcttctccttcctcatctccctcatcttcatctacgag
accttcgacaagctcttcaagatcttcaaggctcacccgctgcagagggtctacaacgtg
acccccacgctgaaccccttggttacccccacggaggagcccaacacggcgctgctctcc
ctcgtgctcatggctggcaccttcttcctggcgctcttcctccgcaagttcaagaacagc
gctttcctgcccggcaaggtccggcgcttggtcggggactttggggtgcccatttccatc
ttcatcatggcgatgattgacttcttcatcaaggacacgtacacgcagaaactgaaggtc
cccaaaggcctcgaggtcaccaacgcgtccgcccgcggctggttcatcagccccatgggc
aacaagaagaccttccccatctggatgatgttcgcctccgtggtgccagccctcttggtc
ttcatcctcatcttcctcgagacgcagatcacgaccctcatcgtcagcaagcctgagcgg
aagctggtgaagggctcaggcttccacctggacctgctgctcatcgtgggcatgggtggt
gtggcagcgctcttcggcatgccctggctcagcgccaccaccgtccgcaccatcacccac
gccaatgccctcaccgtcatgagcaagagctcctctcccagcgagaagtcccagatcctg
gaggtcaaggagcagcgcatcagcggcttgctggtggccgtgctcatcggcgtctccatc
ttcatggagcccatcctgaagtacatcccactggccgtgctcttcggcatcttcctctac
atgggcgtcacctccctcttcggcatccagctctttgaccgcatcctgctcatgctgatg
ccgcccaagtatcaccccaaagagccctacgtcacccgggtgaagacttggcgcatgcac
ctcttcaccttcacccagatcatcaccctcgcggtgctgtgggcggtgaagtccacgccg
gcctcgctagccttgcccttcgtcctcatcctcaccgtgcccgtccggcgcttcctgctg
cccaggatcttccgggacgtcgagctccgatgcctggacgcggacagcgccgccgtcacc
ctggacgaggtggagggcaaggacgtgtacgacgaggtgcagatgcccagctaa

DBGET integrated database retrieval system