KEGG   Apteryx australis mantelli (brown kiwi): 106485081Help
Entry
106485081         CDS       T04298                                 

Gene name
ABHD6
Definition
(RefSeq) abhydrolase domain containing 6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Brite
KEGG Orthology (KO) [BR:aam00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:aam01002]
    106485081 (ABHD6)
Enzymes [BR:aam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     106485081 (ABHD6)
Peptidases [BR:aam01002]
 Serine Peptidases
  Family S33
   106485081 (ABHD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr DUF1057 Thioesterase UPF0227 C9orf72-like DLH Esterase Abhydrolase_3
Motif
Other DBs
NCBI-GeneID: 106485081
NCBI-ProteinID: XP_013798837
Position
Un
AA seq 290 aa AA seqDB search
MQVRYANYDDYQFCYSYRGRPGYRPSILMLHGFSAHKDMWLSIVKFLPKNLHLVCVDMPG
HEGTTRSSLDDYSINGQAKRIHQFVECIKLNRRPFHLVGTSMGGNVAGVYAAQYPDEICS
LTLICPAGLPSSTETKFIKQLRELQESERIDRIPLIPSTPEEMADMLKLCSYVRFKVPQQ
ILQGLVDVRIPHNDFYRKLFLEIVDEKSRHLLHENMHKIKAPTQVIWGKQDQVLDVSGAD
ILAKAIPDCHVYILENCGHTVVVERPRKTAKLMLEFLALLHSTENNKKQA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcaggttagatatgcaaactacgatgactatcagttttgttattcctatagagggaga
cctggataccgaccgtctatcctgatgttacatgggttctcagcccacaaagacatgtgg
ctgtctatagtcaagttcctcccgaaaaatctgcacttagtgtgtgttgacatgcctggt
catgaaggtacaacccggtcatcgttagacgattactccattaatgggcaagctaaaaga
atacaccagtttgttgagtgcatcaagctgaacagaaggccctttcatctggttggcact
tcgatgggaggaaacgtcgcgggagtttatgccgctcagtacccagacgagatctgcagc
ctgacccttatatgtcctgcaggcctgccgagttcgaccgagaccaaattcatcaagcag
ctgcgggagctgcaagagtccgaacgcatcgacaggatcccgttaatcccctcgacgccc
gaagagatggcagatatgctgaaactctgctcttacgttcgctttaaagtgccccagcag
atcctgcagggcctcgttgacgttcgcatcccacacaacgatttctaccggaaactattt
ctagaaatcgtggatgaaaagtccagacatttgctccatgagaacatgcacaagatcaaa
gcgccaacgcaggtcatctggggaaagcaggaccaggtcctggatgtttccggagctgac
attttagcaaaagccattcccgactgtcacgtgtatattctggagaactgtgggcacacg
gtggtcgtggagaggcccaggaagacggcgaagctcatgctcgagtttctggcgctgctg
cacagcacagagaacaacaagaaacaagcgtga

DBGET integrated database retrieval system