KEGG   Apteryx australis mantelli (brown kiwi): 106486192Help
Entry
106486192         CDS       T04298                                 

Gene name
CACNG3
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit gamma 3
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam04010  MAPK signaling pathway
aam04260  Cardiac muscle contraction
aam04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:aam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106486192 (CACNG3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    106486192 (CACNG3)
   04261 Adrenergic signaling in cardiomyocytes
    106486192 (CACNG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:aam04040]
    106486192 (CACNG3)
Ion channels [BR:aam04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   106486192 (CACNG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 106486192
NCBI-ProteinID: XP_013800185
Position
Un
AA seq 308 aa AA seqDB search
MRMCDRGVQMLVTTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNDTSRKNEEVMTH
SGLWRTCCLEGTFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSIFPILSVGLLFFGGL
CVAASEFYTPLRLSPPHPGLSNIIGIIVYISANAGDPGQSDSKKSYSYGWSFYFGALSFI
IAEMVGVIAVHMYIEKHRQIRAKSHAELLKKSAFTRLPTYRYRFRRRSSSRSTEPRSRDM
SPVSKGFSTIPSTDISMFTLSRDPSKVTIGTLLNSERDHSFLQVHNSIPKEFKESLHNNP
ANRRTTPV
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgtgtgacagaggcgtccagatgctcgtcaccacggtgggagccttcgcagcc
ttcagcttgatgaccatcgccgtgggcacggactactggctctactcgcgcggcgtgtgc
aggactaagtccacgagcgacaacgacaccagccgcaagaacgaggaggtgatgacccac
tcggggctctggaggacgtgctgtctggaaggaaccttccgcggcgtctgcaagaaaatc
gaccacttccccgaggacgcggattatgagcaggacacggccgagtatctgctccgcgcc
gtgagagcctccagcatcttccccatcctcagcgtgggcttgctgttcttcgggggcctc
tgcgtggcggccagcgagttttacacacctctccgtctctcgcccccccacccaggtctc
agcaacatcatcgggatcatcgtctacatctcggcaaacgccggcgacccggggcaaagc
gactccaagaagagctactcctacggctggtccttctacttcggcgctctgtccttcatc
atcgccgagatggtgggggtcatcgccgtgcacatgtacatcgagaagcaccgccagatc
cgcgccaagtcccacgcggagctgctgaagaagtcggccttcacgcgcctccccacctac
aggtaccgcttccgccggcggtccagctcccgctccaccgagccccggtcccgggacatg
tcgcccgtgagcaaaggtttcagcaccatcccgtccaccgacatctccatgttcaccctc
tccagggatccctccaaggtcaccatagggacgctgctcaactcggagcgggaccacagt
tttttacaggtccataactccatccccaaagagttcaaggagtctttgcacaacaacccg
gccaacagacgaaccacgccggtctga

DBGET integrated database retrieval system