KEGG   Apteryx australis mantelli (brown kiwi): 106486200Help
Entry
106486200         CDS       T04298                                 

Gene name
PLK1
Definition
(RefSeq) polo like kinase 1
  KO
K06631  polo-like kinase 1 [EC:2.7.11.21]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam04068  FoxO signaling pathway
aam04110  Cell cycle
aam04114  Oocyte meiosis
aam04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:aam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106486200 (PLK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106486200 (PLK1)
   04114 Oocyte meiosis
    106486200 (PLK1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    106486200 (PLK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aam01001]
    106486200 (PLK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aam03036]
    106486200 (PLK1)
Enzymes [BR:aam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     106486200 (PLK1)
Protein kinases [BR:aam01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   106486200 (PLK1)
Chromosome and associated proteins [BR:aam03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     106486200 (PLK1)
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    106486200 (PLK1)
  Sister chromatid separation proteins
   Polo kinases
    106486200 (PLK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: POLO_box Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 106486200
NCBI-ProteinID: XP_013800193
Position
Un
AA seq 418 aa AA seqDB search
MEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLGKKGHSFEVDIWSIGCIMYTLLVG
KPPFETSCLKETYIRIKKNEYTIPKHINPVAANLIQKMLRSDPATRPTIDELLNDEFFTS
GYIPNRLPTSCLTVAPRFSIAPSGLDLNGRKPLTALNKGPDSPALESLPEKDDVAGLREL
GDAVDCHLADMLQQLTAVNSAKPSERVVVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQ
LCDNSVGVLFNDSTRLIMYNDGDSLQYIEQNSTESYFTVRSYPSALNKKITLLKYFRNYM
SEHLLKAGANITPREGDELARLPYLCTWFRTRSAIILHLSNGTVQINFFQDHTKVILCPL
MAAVTYIDEKRDFRTYKLSLIEEHGCCKELASRLRYARTMVEKLLSSKSGSARVKPSV
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgaagatcggtgactttggcctggccaccaaagtggagtatgacggcgagcgt
aagaagaccttgtgtgggaccccgaactacattgccccagaggtgctgggcaagaagggg
cacagcttcgaggtggacatctggtccatcggctgcatcatgtacactctgctggtaggg
aaaccgcctttcgaaacctcttgtctaaaggaaacttacatccgaattaagaagaatgaa
tataccatccccaagcacatcaaccctgtagctgctaacctcatccagaagatgctgagg
tctgaccctgccacgcgcccgactatcgacgagttgctgaatgacgagttcttcacgtca
ggatacatccccaaccgcttgcccaccagctgtctcaccgtcgcacctaggttttcaatt
gctcccagcgggcttgatctgaacgggcgaaagccactgactgcactcaacaaaggacca
gacagccctgcactagagagcttgcctgaaaaagatgatgtagctgggctgcgggagctg
ggagatgctgttgactgtcacttagcagacatgttacagcagctgactgcagtcaattca
gccaagccatctgagagagtggtggtgagacaagaagaggctgaagacccagcctgcatt
cctatcttctgggttagcaaatgggtggactactcagataaatatggtctaggttatcag
ctgtgcgacaacagtgttggagttctcttcaatgactccactcgtcttattatgtacaat
gacggggacagcttgcagtacatcgagcaaaacagcacagagtcctacttcactgtgaga
tcctatccctctgccttgaacaagaagataacactattgaaatacttccggaactacatg
agcgagcacctgctgaaggcaggtgctaacatcacgcctcgggaaggagatgagctggct
cgtttaccctacctctgcacgtggttccggacccgcagcgccattatcctgcacctcagc
aatggcactgtgcagatcaacttcttccaggaccacaccaaagtcatcttgtgccctctc
atggctgctgtcacatacatagatgagaaacgggacttccgcacgtacaagctgagtctc
atcgaggaacatggatgctgcaaggagctggccagccggctccgctacgctcgcaccatg
gtggagaagctcctcagctcaaagtctggctcagcccgcgtgaaaccttctgtttag

DBGET integrated database retrieval system