KEGG   Apteryx mantelli mantelli (brown kiwi): 106486591
Entry
106486591         CDS       T04298                                 

Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
aam  Apteryx mantelli mantelli (brown kiwi)
Pathway
aam04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:aam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106486591
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aam03000]
    106486591
Transcription factors [BR:aam03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    106486591
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_8 zf-C2H2_11 PyrI_C
Other DBs
NCBI-GeneID: 106486591
NCBI-ProteinID: XP_013800660
Position
Un
AA seq 1053 aa
MKSEDYSHETMAPDIHEERQYRCEDCDQLFESKAELVDHQKFPCSTPHSAFSMVEEDFQK
KLDTENDLRDAHEIQECKECDQVFPDLQSLEKHMLSHSEEREYKCDQCPKAFNWKSNLIR
HQMSHDSGKHYECENCAKQVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHK
HIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFC
EGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMNHANPGLADYFGANRHPAGLTFPTAPGF
SFSFPGLFPSGLYHRPPLIPTSSPVKGLPSTDQTNKSQSPLMTNPQILPATQDILKALNK
QPSVGENKPVELQPERSSEERPHEKLSDQSESSDLDDVSTPSGSDLETTSGSDLESDIES
EKEKFKENGKMFKDKVSSLQNLASINNKKEHSNHSIFSPSLEEQTAVSGAVNDSIKAIAS
IAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRPLPLKMEPQSP
SEIKKIPKGSSESPFDLTTKRKEEKPVTPIPSKPAAPPVTSQDQPLDLSMGSRSRASGTK
PAEPRKNHVFGEKKGGDLEQRKVSESSLQHARPTPFFMDPIYRVEKRKLTDPLEALKEKY
LRPSPGFLFHPQFQLPDQRIWMSAIENMAEKLESFSALKPEASELIQSVPSMFNFRAPPS
ALPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRH
VRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDK
EDSYFTEIRNFIGNSNHNNQSPRSSEERMNGSHFKDEKAMVAGQNSDLLDDEEAEDEVMM
DEEDEETEIAGKAVKEPVTSDIHEGTPEEDYEETSTLDMNCKASPGRYKEDEYNKTGLSA
LDHIRHFTDSLKMRKMEENQYNETELAAFNTSQLPEDLKQPLYRKSKSQAYAMMLSLSDK
DSLHSASHSSPNMWHSMARAAAESSAIQSISHV
NT seq 3162 nt   +upstreamnt  +downstreamnt
atgaagagtgaagattattcacatgaaacaatggctccagacattcacgaggagcgccag
tatcgctgtgaggactgcgaccagctctttgagtccaaggctgaactagtagaccaccag
aagttcccttgcagcacacctcactctgcgttctccatggtggaggaggactttcagaaa
aagcttgacactgagaatgaccttcgggatgcgcatgaaatccaggaatgtaaagagtgt
gatcaagtcttcccagacttacaaagcctggagaagcacatgctgtcgcacagcgaggag
agggagtacaagtgcgatcagtgccccaaagcttttaactggaagtccaacttgatacgt
catcagatgtcgcatgacagcgggaagcactacgagtgtgaaaactgtgccaagcaggtt
ttcacggaccccagcaaccttcagaggcatattcgttcccagcatgttggggctcgtgct
cacgcttgtccagagtgtggcaaaacctttgccacttcttcaggcctcaaacagcataaa
cacatccacagcagtgtcaaaccttttatatgtgaggtctgccataaatcctatactcag
ttttcaaacctttgtcgtcataagcgcatgcatgctgattgcagaacccaaatcaagtgc
aaagactgtggacaaatgttcagcactacgtcttccttaaataaacacaggagattttgt
gagggcaagaaccattttgcagcaggaggattttttggccaaggcatttcacttcctgga
accccagctatggataaaacgtccatggttaatatgaatcatgcaaatccgggccttgct
gactattttggagccaataggcatcctgctggtcttacctttccaacagctcctggattt
tcttttagcttccctggtctgtttccttcaggcttgtaccacaggccacctttgatacct
actagttctcctgttaaaggactaccaagcacagatcagacaaacaaaagtcaaagtccc
ctcatgacaaatcctcagatactgccagctacacaggatattttgaaggcactaaataag
caaccatctgtaggtgaaaataagccagtggagcttcaaccagagaggtcctctgaagag
aggccgcatgaaaaactcagtgaccagtcagagagtagtgaccttgacgatgtcagtacc
cccagtggcagtgacctggaaaccacctctggctctgatctggaaagtgacattgaaagt
gagaaagagaaatttaaagaaaatggtaaaatgttcaaagacaaagtaagctctcttcag
aatttggcttcaataaataataagaaagaacacagcaatcattccattttctcaccatct
ttagaggagcaaactgcggtgtcaggagctgtgaatgattctataaaggctattgcttct
attgctgaaaaatactttggttcaacaggacttgtggggctgcaagacaaaaaagttgga
gccttaccttacccttccatgtttcccctcccattttttccagcattctctcaatcaatg
tatccatttcctgatagagacttgagaccgttacccttgaaaatggagccccaatcaccc
agtgaaattaagaagatcccaaagggaagctctgagtctccctttgacctcaccactaag
cgtaaggaggagaagccagttactcctataccctcaaagccagcagctccacctgtgaca
agccaggaccagcctctagatctcagcatgggcagcagaagtcgagccagtggcacaaaa
ccggccgagcctcggaaaaaccacgtctttggtgaaaagaaaggaggtgaccttgaacaa
aggaaagtttctgagtcttctttgcagcatgccagaccaactccgttctttatggatccc
atttacagagtagagaaaagaaagttaactgacccgctcgaagctttaaaagaaaagtac
ttgagaccttccccaggattcttgtttcatccacaattccaattgcctgatcaaagaatt
tggatgtcggctatcgaaaacatggctgagaagctggagagttttagcgccctgaagcca
gaggccagcgagctgatccagtcggtgccgtctatgttcaacttcagagcccctccgagc
gccctgccggagaacctgctgcgcaagggcaaggagcgctacacctgcagatactgtggc
aagattttcccaagatctgcaaacctaacacgtcacctgaggacgcacactggagagcag
ccctatagatgcaaatactgtgacaggtcctttagcatatcttctaacctgcagagacat
gtccgtaacatccacaataaagagaagcccttcaaatgtcacttgtgtgacaggtgtttt
ggtcaacaaaccaatcttgacagacatctaaaaaagcacgagaacggcaacatgtctggt
actgcaacatcttcacctcactcagaacttgaaagcacaggggcaatcctagacgacaag
gaagattcttacttcacagaaattaggaattttattgggaacagcaaccacaataatcaa
tcccccagaagctcagaggagagaatgaatggcagccactttaaggatgagaaagccatg
gtagccggccagaactcagatttgttggatgacgaggaggcagaagatgaagtaatgatg
gacgaagaagatgaagaaactgaaattgcagggaaagcagtcaaagaacctgttacaagt
gacatacatgaggggactccagaggaagattacgaggaaacgagtactttggacatgaac
tgcaaggcttcccctggcaggtataaagaggatgagtacaataagactggactttcggct
ttggaccacataaggcacttcacagatagcctcaaaatgaggaaaatggaagaaaatcaa
tataatgaaactgaattggcagctttcaatacttcccagctgccggaggacttaaaacaa
ccgttgtacaggaaatccaaatcccaggcgtacgcgatgatgctctctctctctgacaag
gactcccttcattctgcatcccatagttctcccaatatgtggcacagtatggccagagct
gccgcagaatccagcgccattcaatccatcagtcacgtatga

DBGET integrated database retrieval system