KEGG   Apteryx australis mantelli (brown kiwi): 106486701Help
Entry
106486701         CDS       T04298                                 

Definition
(RefSeq) glycogen [starch] synthase, muscle-like
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam00500  Starch and sucrose metabolism
aam01100  Metabolic pathways
aam04910  Insulin signaling pathway
Module
aam_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:aam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    106486701
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106486701
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:aam01003]
    106486701
Enzymes [BR:aam01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     106486701
Glycosyltransferases [BR:aam01003]
 Polysaccharide
  Storage polysaccharide
   106486701
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn
Motif
Other DBs
NCBI-GeneID: 106486701
NCBI-ProteinID: XP_013800797
Position
Un
AA seq 101 aa AA seqDB search
MHEFQNLHAQSKARVQEFVRGHFYGQLDFDLDKTLFFFIAGRYEFSNKGADVFLEALARL
NYLLRVNGSETTVVAFFIMPARTNNFNVETLKGQAVRKQLW
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgcacgagttccagaacctgcacgcccagagcaaggcccgcgtccaggagttcgtccgc
ggccacttctacgggcaactggacttcgacctggacaagacgcttttcttcttcatcgcc
ggccgctacgagttctccaacaagggagccgacgtcttcctcgaggcgctggcccggctc
aactacctgctgcgggtcaacggcagcgagaccacggtcgtcgccttcttcatcatgccg
gcacggaccaacaacttcaacgtggagacgctcaagggccaggccgtgcgcaagcagctc
tggtga

DBGET integrated database retrieval system