KEGG   Apteryx australis mantelli (brown kiwi): 106487024Help
Entry
106487024         CDS       T04298                                 

Gene name
MGAT2
Definition
(RefSeq) mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam00510  N-Glycan biosynthesis
aam01100  Metabolic pathways
Module
aam_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:aam00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    106487024 (MGAT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:aam01003]
    106487024 (MGAT2)
Enzymes [BR:aam01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     106487024 (MGAT2)
Glycosyltransferases [BR:aam01003]
 Glycan extension
  N-Glycan
   106487024 (MGAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2 Gp45_2
Motif
Other DBs
NCBI-GeneID: 106487024
NCBI-ProteinID: XP_013801169
Position
Un
AA seq 299 aa AA seqDB search
MRWLSTFRRTRLGRAEADTAETNTCTAEYTSGQLYPREFPGHDPRDCPRDIGKAAALRLG
CINAEYPDSFGHYREARFSQTKHHWWWKLHFVWERVRALREHAGPVLFLEEDHYLAPDFY
HVLKKLWALRGREXXXXXXXSLGSYGLVRGGFAGRADKVEMKTWKSTEHNMGMAFGRDTY
QQLMACTDAFCTYDDYNWDWTLQHLTVSCLPKFWKVLVPEIPRIFHTGDCGMHHKKSCRP
STQSAKIDSLLNSNQQHLFPEAMSVSKRYSMAPLSPHVKNGGWGDIRDHELCKSYRRLQ
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcgatggctgagcaccttccggaggacacggctgggccgagcggaggcagataccgcg
gagacaaacacctgcacggctgagtacacgagcggtcagctctacccccgcgagttcccc
gggcacgacccgcgcgactgcccgcgcgacatcggcaaggcggcggcgctgcgcctcggc
tgcatcaacgccgagtaccccgactccttcgggcactaccgcgaggcccgcttctcgcag
accaagcaccactggtggtggaagctgcacttcgtctgggagcgggtgcgggcgctgcgg
gagcacgccgggcccgtgctcttcctggaggaggaccactacctggcccccgacttctac
cacgtcctcaagaagctgtgggccctgcgcgggcgggagnnnnnnnnnnnnnnnnnnntg
tccctgggcagctacggcctcgtccgcggcggcttcgccggcagggccgacaaggtggag
atgaagacgtggaagtccaccgagcacaacatgggcatggccttcggcagagacacctac
cagcagctcatggcgtgcacggacgccttctgcacttacgatgactataactgggactgg
actctgcagcatttgactgtctcttgtcttccaaagttctggaaagtgctggttcccgag
atccccaggatttttcacactggggactgcggcatgcaccacaagaagtcctgcagaccg
tccacccagagtgccaaaatcgactcgctcttgaacagcaaccaacagcacctgtttccc
gaagcgatgagtgtcagtaaaaggtactctatggcacccctgtcccctcatgtgaaaaac
ggagggtggggagatattagggaccacgaactctgtaaaagttaccgcagacttcagtga

DBGET integrated database retrieval system