KEGG   Apteryx australis mantelli (brown kiwi): 106489037Help
Entry
106489037         CDS       T04298                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol-polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam00010  Glycolysis / Gluconeogenesis
aam00562  Inositol phosphate metabolism
aam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106489037 (MINPP1)
   00562 Inositol phosphate metabolism
    106489037 (MINPP1)
Enzymes [BR:aam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     106489037 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     106489037 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 106489037
NCBI-ProteinID: XP_013803620
Position
Un
AA seq 295 aa AA seqDB search
MVLTEQLQSTLFPHASFFCVQHEMEIEVNDSLMRFFEHCQKFVALVEENKTATHQVDAFK
KGPEMRRVLEKVASVLCLPADELNADLIQVAFLTCSYELAIKNMTSPWCSLFNEEDAKVL
EYLNDLKQYWKRGYGYDINSRSSCNLFQDIFQQLDKAVEESKSSKPISSPVIVQIGHAET
LQPLLALMGFFKDDEPLRANNYVKQTHRKFRSGRIVPYAANLVFVLYHCDQVKTSKEEYQ
VQMLLNEKLLPFHHSNKTISVYADLKDYYKDILQNCHFKEECELPKNNNTATDEL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgacggagcagctacagtcgacgttattccctcacgcttccttcttctgtgtc
cagcatgaaatggagatcgaggttaacgactccttaatgaggtttttcgagcactgccag
aagttcgtggccctggtggaagagaacaagacggccacgcatcaagtggacgccttcaag
aagggtccggagatgaggcgggttttggaaaaagtagccagcgttttgtgtttgccggcg
gacgagttaaacgcagatctcattcaagtggcttttctcacctgctcgtatgagttggca
ataaaaaatatgacctccccatggtgttcgctcttcaatgaagaggatgccaaggtactg
gaatatctgaatgacctgaagcagtactggaagagaggatatggctatgacatcaatagt
cgctccagctgcaatttattccaggatatcttccagcagttggacaaagcggtggaagag
agcaaaagttcaaagcccatttcttcacctgtgattgtacaaattggacatgcagagaca
cttcagccactgctcgctcttatgggcttcttcaaagatgacgagcctctcagggcaaac
aattacgtcaaacaaacgcatcggaaatttcgcagtggccggattgtgccttatgcagca
aacctggtatttgtactttatcactgtgatcaagtgaaaacctctaaagaagagtatcaa
gtgcagatgctgttgaatgaaaagttgctgccgtttcatcactcaaataaaaccatctct
gtttatgcagacctcaaggactattataaggatatccttcaaaactgccacttcaaagaa
gaatgtgaattaccaaaaaataataatactgctactgatgaactttga

DBGET integrated database retrieval system