KEGG   Apteryx australis mantelli (brown kiwi): 106490525Help
Entry
106490525         CDS       T04298                                 

Gene name
DOCK7
Definition
(RefSeq) dedicator of cytokinesis 7
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
aam  Apteryx australis mantelli (brown kiwi)
Brite
KEGG Orthology (KO) [BR:aam00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aam04131]
    106490525 (DOCK7)
Membrane trafficking [BR:aam04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    106490525 (DOCK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N TEA
Motif
Other DBs
NCBI-GeneID: 106490525
NCBI-ProteinID: XP_013805412
Position
Un
AA seq 2144 aa AA seqDB search
MEFDTFVNAVIQREIILSLSHFRTVAAEVRKQISGQYGGSPQLLKNLNIGGSVSHHTTVP
LTEAVEPVDLEDYLITHPIAVESGPLRDLLEFPPDDIEVVYTPRECRTLVSAVPEESEMD
PHVRDCVRSYTEDWAIVNRKYHKLGTGFNPNTLDKQKERQKGLPKQIFESDEAPDGNSYQ
DEQDDLKRRSMSIDDTPRGSWACSIFDLKNSLPDALLPNLLDRTPNEEIDHHNEDQRKSS
RHKELFALHPAPDEEEPIERLSVPEVPKEHFGQRLLVKCLSLKFEIEIEPIFASLALYDV
KEKKKISENFYFDLNSEQMKGMLRPHVPPAAISTLARSAIFSITYPSQDVFLVIKLEKVL
QQGDIGECAEPYMIFKESDAAKNKEKLEKLKCQAEQFCQRLGKYRMPFAWTAIHLMNIVS
SAGSLERDSTEVEVGTGERKGSWSERRNSSIVGRRSLERTTSGDEACNLTSFRPATLTVT
NFFKQEGDRLSDEDLYKFLADMRRPSSVLRRLRPITAQLKIDISPAPENPHYCLTPELLQ
VKLYPDSRVRPTREILEFPARDVYIPNTTYRNLLYVYPQSLNFANRQGSARNITVKVQFM
YGEDPSNAMPVIFGKSSCPEFSKEAYTAVVYHNRSPDFHEEIKIKLPATLTDHHHLLFTF
YHVSCQQKQNTPLETPVGYTWIPMLQNGRLKTGQFCLPVSLEKPPQAYSVLSPEVPLPGM
KWVDNHKGVFNVEVVAVSSLHTQDPYLDKFFALVHALDEHMFPVRIGDMRIMENNLENEL
KSSISALNSSQLEPVVRFLHLLLDKLILLVVRPPVIAGQIVNLGQASFEAMASIINRLHK
NLDGNQDQHGRNSLLASYIYYVFRLPNTYPNSPSPGPGGLGGSVHYATMARSAVRPASLN
LNRSRSLSNSNPDISGTPTSPDDEVRSIIGSKGLDRSNSWVNTGGPKAAPWGSNPSPSAE
STQATDRSCNRMSSHTETSSFLQTLTGRLPTKKLFHEELALQWVVCSGSVREAALQQAWF
FFELMVKSMVHHLYFADKLDAPRKNRFPERFMDDVTALVSTIAGDIVSRFQKDTEMVERL
NTSLAFFLNDLLSIMDRGFVFVLIKTCYKQVSSKLYSLTNPSNLASLRLDFLRIICSHEH
YVTLNLPCSLLTPPASPSPSVSSATSQSSGFSTNVQDQKIANMFELSVPFRQQHYLAGLV
LTELAVILDPDAEGLFGLHKKVINMVHNLLSSHDSDPRYSDPQVKARVAMLYLPLIGVIM
ETVPQLYDFTESHNQRGRPSCVAADDYESEGGSMISQTVAMAIAGTSVPQLTRPSSFLLT
SSSGRQHSTFSTESSRSLLICLLWVLKNADESVLQKWFTDLSVLQLNRLLDLLYLCVSCF
EYKGKKVFERMNSLTFKKSKDMRAKLEEAILGSIGARQEMVRRSRGQLERSPSGSAFGSQ
ENLRWRKDMTHWRQNTEKLDKSRAEIEHEALIDGNLATEANLIILDTLEIVVQTVSVTES
KESILGGVLKVLLHSMACNQSALYLQHCFATQRALVSKFPELLFEEETEQCADLCLRLLR
HCSSSISTIRSHASASLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTSQNFNEEFLRRS
LKTILTYAEEDLELRETTFPDQVQDLVFNLHMILSDTVKMKEHQEDPEMLIDLMYRIAKG
YQNSPDLRLTWLQNMAGKHSERSNHAESAQCLVHSAALVAEYLSMLEDRKYLPVGCVTFQ
NISSNVLEESAVSDDVVSPDEEGICSGKYFTEAGLVGLLEQAAASFSMAGMYEAVNEVYK
VLIPIHEANRDAKKLSTIHGKLQEAFSKIVHQSTGWEDGKRMFGTYFRVGFYGTKFGDLD
EQEFVYKEPAITKLAEISHRLEGFYGERFGEDVLEVIKDSNPVDKCKLDPNKAYIQITYV
EPYFDTYEMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYI
KTRINVIHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQG
PLEVAQVFLSEIPNDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELER
NYHRLKEALQPLINRKIPQLYKAVLPVACHRDSFSRMSLRKMDI
NT seq 6435 nt NT seq  +upstreamnt  +downstreamnt
atggagttcgatacgtttgtgaatgcagtgatacagagagagataatattgtccctgtct
catttcagaactgtagctgcggaagtcaggaagcagatctcagggcagtatggaggatct
ccccagcttctcaaaaacctcaacattggaggcagtgtctcccatcacacaactgtaccg
cttacagaagcagtggaaccagttgatttggaagactaccttattacccacccgattgcg
gtggaatctggccccttgagagacttgcttgagtttcctccagatgacatcgaggtggtg
tacaccccccgagaatgtcgaactcttgtgtcggctgtacctgaagagagtgagatggac
cctcatgtgagggattgtgtaagaagttacacagaagactgggcgattgtgaacagaaaa
tatcacaaactgggaacaggatttaatcccaacaccttagacaaacagaaggagaggcaa
aaggggctccccaagcagatctttgagtctgacgaagctccagatggcaacagttaccag
gatgaacaagatgaccttaaacggcgatcaatgtcaattgacgatactccccggggcagc
tgggcatgcagtatttttgatctgaagaactcccttccagatgcccttcttccaaaccta
ctggaccgaaccccaaatgaagagattgaccaccacaatgaagatcagaggaagtccagt
aggcataaggagctttttgcactacacccagcgccagatgaggaggagcctatagaacga
cttagtgtccctgaagtacccaaagaacattttggccagagactcctggtgaaatgtttg
tctcttaaattcgaaatagaaattgaacccatttttgcaagtttggctttgtatgatgtt
aaagaaaagaaaaagatttcagaaaatttctactttgatttaaactctgaacaaatgaaa
ggaatgcttcgtccacatgtacctcctgctgctatatccacactggccagatctgccata
ttttccatcacttatccctctcaagatgtctttctggtaataaagctggaaaaagtatta
cagcagggagatattggggagtgtgcagagccttatatgatttttaaagaatctgatgca
gcaaagaataaggaaaagttggaaaaactgaaatgtcaggcagaacagttttgccaaaga
ctaggcaagtatcgaatgccttttgcttggacagccattcatttaatgaatattgtgagc
agcgctggaagtttggaaagagattccacagaagtagaagttggcacaggagaacgtaaa
ggatcttggtcggagagacggaattccagtattgttgggagacgttcgttagaaagaacc
actagtggggatgaagcttgcaatttgaccagttttagaccagctactctgacagtgaca
aacttctttaaacaggagggtgatcgcctgagtgatgaagatttgtacaagtttcttgca
gatatgagaagaccatcatcagtgttacggagattgaggcctatcacagctcaactaaag
atagacatatctccagctccagagaatccccattactgtctaactccagagttgctgcaa
gtcaaactttacccagacagcagagttagacctacaagagaaatcctggagtttcctgcc
agggatgtctacattccaaataccacatacaggaatcttctttatgtctatcctcagagc
cttaactttgccaaccgccaaggatctgccaggaatatcactgtaaaagtccagttcatg
tatggagaggatccaagcaatgctatgccggtcatctttggcaaatctagctgtcctgag
ttttccaaagaagcgtacacagctgtagtatatcacaacagatcacctgattttcatgag
gaaatcaagattaagcttccagccactttaacggatcaccaccacctgctttttactttc
taccatgtcagttgccaacaaaaacaaaacactcccctggaaactccggttggatacact
tggataccgatgcttcaaaatggacggttaaagactggtcagttctgcctacctgtttca
ttggaaaaaccaccacaggcttattcagtgctttctccagaggtgccacttcctggaatg
aagtgggtagataatcacaaaggtgttttcaatgtggaagttgttgctgtatcatccctc
catactcaggacccttatcttgacaagttctttgcacttgtccatgctctggatgagcac
atgttccctgtgcgaataggagacatgagaattatggaaaacaacttggaaaatgaactg
aagagcagcatttcagctttaaattcctctcaactggagccggtagtgcgatttcttcat
ctcctgcttgacaaactgattcttctggtagtaagacctcctgtcattgcaggccaaata
gttaacctgggccaagcatcttttgaagcaatggcatcgattataaacagacttcacaaa
aacttggacggaaaccaggaccagcacggcagaaacagccttcttgcttcctatatttat
tatgtttttcgcctaccaaatacctatcccaattcaccatcaccaggtcctggtggctta
gggggatcagtgcattatgccaccatggctcgatctgctgtccgaccggcaagcctgaac
ttgaaccgctcgcggagtctcagcaacagcaacccagatatatctgggacccccacctca
ccagatgatgaagttcgctccatcattggcagtaagggtttagaccgctccaattcctgg
gtaaacactggtggtccaaaagcagccccatggggatccaaccccagcccaagtgcagag
tcaacacaggctaccgatcgaagttgtaatcgtatgtcttcgcacactgagacgtcaagt
ttcttacaaacattaacaggacgattaccaactaaaaagctttttcacgaagagctggcc
ttacagtgggtcgtgtgcagtgggagtgtgcgggaggcagccctacagcaggcctggttc
ttctttgaactgatggtgaagagcatggtgcatcatttgtattttgctgacaaactggat
gctccaagaaagaatcgttttcctgagcgtttcatggatgatgtaactgctttggtcagc
acaattgctggtgatatagtctctcggtttcagaaggatacagaaatggttgaaaggctc
aacaccagtcttgcatttttcctcaatgatctgttgtctatcatggacagagggtttgtc
tttgtccttattaagacctgctacaaacaggtgtcttcaaagctctattccttaacaaac
ccaagtaacctggcgtctttgagactggacttccttcgcatcatctgcagccatgagcac
tatgtcaccttgaatttgccctgcagcttgctcacaccgcctgcatctccatcaccatct
gtgtcttcagcaacttctcagagttctgggttctccacaaacgtccaagaccagaagatt
gcaaatatgtttgaattgtctgtgcctttccgccaacagcattacttggctgggcttgtt
ttaacagaactggctgtcattttagatcctgatgcagaaggtttatttggattgcataag
aaggtcatcaatatggtacacaatttactgtccagccacgactcggatccgcggtactct
gacccacaggtaaaggcccgggtggctatgctgtatctacctctgattggcgtgatcatg
gaaaccgtgcctcagctttatgattttacagagagtcacaatcagcgagggaggccaagc
tgcgtcgctgctgatgattatgaaagcgagggtggaagcatgataagccagacagttgcc
atggccattgcaggaacatcggtccctcagctcacccggcccagcagttttctactcacc
tcatcgagtggaaggcagcactccaccttctcaacagagtccagccgtagcctcttgatc
tgtctcttgtgggtgctcaaaaatgcagatgaaagtgtcctgcagaaatggttcacagac
ctgtcagtgctgcagctcaatcgcctgctggatttgctttatctctgcgtatcctgcttt
gagtacaagggcaagaaagtgtttgaaagaatgaacagtctgacattcaagaagtcgaag
gacatgagagccaaacttgaagaagctattttgggaagcataggagcaaggcaggaaatg
gtccgaagaagtagaggacagctagagagaagtccttccggaagcgcatttggaagtcaa
gagaatttgagatggagaaaggatatgactcactggcgtcaaaacacagaaaagcttgac
aaatcaagggcagagatagaacatgaggcacttattgatggaaatcttgcaacggaagca
aatctgattattttggatacattagagatagttgtccagactgtttctgtgacggagtcc
aaagaaagtatcctcggcggggtgctgaaggtgcttctgcacagcatggcctgtaaccaa
agtgcactttatctccaacactgcttcgccacacagagggctttggtttcaaagttccct
gagctgctgtttgaagaagagactgagcagtgtgcagatctgtgcctgaggctcctgaga
cactgtagcagcagtatcagcacaatacggtcacatgcgagtgcctctctttaccttctg
atgaggcaaaactttgagattgggaataactttgccagagtgaaaatgcaagtgaccatg
tctctctcatccctggtggggacatcccagaatttcaatgaggaatttttacgacgttcc
ctgaaaactattttgacatatgctgaagaagatctggaacttagggagacaacattccct
gatcaggtccaggatcttgtgttcaacctccatatgatcctctctgacacagttaaaatg
aaggagcaccaggaagatccagaaatgctgattgacctcatgtacaggattgcaaagggc
tatcagaattcccctgacctgcgcctgacctggttacagaacatggctgggaagcactca
gagagaagcaatcatgctgaatcggcccagtgtttggtccattcggcagccttggtggct
gaatatctaagcatgcttgaagaccggaaatacctccccgtagggtgtgttacatttcag
aacatatcttctaatgttttggaagagtcagcagtttctgatgatgttgtatcaccagat
gaagaaggtatctgttctgggaagtattttacagaagctggtctggtgggattgctggaa
caggctgcagcatctttctcaatggctggcatgtatgaagcggttaatgaggtttacaaa
gtccttattcctattcatgaagctaatagagatgccaagaaactatctactattcatggt
aaactccaagaagcattcagcaagattgttcatcagagtactggctgggaggatggaaag
aggatgtttggcacctatttccgggttgggttttatggaactaaatttggagacctggat
gagcaagaatttgtttacaaggaacctgcgataacaaagttagctgaaatctcccatagg
ctcgagggattttacggagaacggtttggtgaagatgtgcttgaagtgattaaggactca
aaccctgtggacaaatgtaaactagatcctaacaaggcctatattcagataacctacgtg
gagccttactttgacacgtatgagatgaaggacaggataacttacttcgacaaaaactac
aacttgcggcgtttcatgtattgcacgcccttcacgctggacggccgagctcatggggag
ctgcacgagcagttcaagcgcaaaacaatcctgacaacgtcccatgctttcccttacatt
aaaaccaggataaacgtcattcacaaagaggagatcattttgacgcccattgaagttgcc
atagaggacatgcagaagaaaacacaggaattagcttttgcaactcaccaagaccctgcg
gatccaaagatgctgcagatggtgctgcaaggatcagtaggtaccacagtaaaccaggga
ccattagaagttgcacaagttttcttgtctgaaatacccaatgatccaaagctcttcaga
catcataacaaactacggctctgtttcaaagacttcacaaaaagatgtgaagatgctctg
cgcaagaataagagcctgatcggtccagaccaaaaggagtatcagcgagaacttgaaagg
aattatcaccggttaaaggaagctctccagcctttgataaatagaaagatcccgcaatta
tataaggcagtgctgccagtcgcttgccacagagactccttcagcaggatgagccttcgc
aaaatggatatctaa

DBGET integrated database retrieval system