KEGG   Apteryx mantelli mantelli (brown kiwi): 106491073Help
Entry
106491073         CDS       T04298                                 

Gene name
CPT2
Definition
(RefSeq) carnitine palmitoyltransferase 2
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
aam  Apteryx mantelli mantelli (brown kiwi)
Pathway
aam00071  Fatty acid degradation
aam01212  Fatty acid metabolism
aam03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:aam00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106491073 (CPT2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    106491073 (CPT2)
Enzymes [BR:aam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     106491073 (CPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 106491073
NCBI-ProteinID: XP_013806060
Position
Un
AA seq 632 aa AA seqDB search
MCKKWVFISTTAHKVCISPFSPSFRLPVPKLEDTIRRYLNAQKPLLNDDQFRKTEELARH
FEKGIGRQLHEQLVAQDNQNKHTSYITGPWFDMYLKAREPVVLNFNAFMSFHPDPKSEYN
DQLIRATNMTVSALRFMKTFRAGYLEPEVFHLNPKKSDTELFKKLIRFVPSSLSWFGAYM
VNAYPLDMSQYFRLFNSTRLPKLNRDELYIDEKAKHLLVLRNGNFYVFDVIDRDGNMLKP
SEIQAHLKYILSDNSPTPAFPLGYLSSENRDTWALLRKNLLDNGNEEALQKVDSAVFCLS
LDDFPVKDFVHLSHTMLHGDAANRWYDKSFNLIITKDGTAGVNFEHSWGDGVAVLRFQNE
VFKDSVGEPAVSPQSQPASVDSSRAVRRLDFKLNDALKAGITKAKQNFDSTVEALTLDMI
QFQKGGKDLLKQKKVSPDAVAQLAFQMAFLRQYNQTVATYESCSTAAFKHGRTETIRPAS
IHTKKCSEAFVKEPSKHSTEELQKMIMECSEYHGRLTKEAAMGQGFDRHLFGLRCLALSK
GTSLPDFYQDQAYARLNHNIISTSTLVSPAVQLGGFGPVVPDGFGVGYQVHGDWIGCNVS
SYPARNAKEFLQCIYKSLEDIFNVLKGKKISS
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaagaaatgggtcttcattagtactactgctcataaagtgtgcatctctcccttt
tccccttccttcaggctgcccgttcccaaactagaagatacaataaggagatacctgaat
gcccaaaaacctcttttaaatgatgaccagttcagaaaaacagaagaacttgctcgtcac
tttgaaaaaggaattggaagacagctgcatgagcaactagttgcacaagacaatcagaac
aagcatactagttacatcacaggtccctggtttgatatgtacttgaaagctcgtgaacct
gttgttttgaattttaatgcatttatgtcttttcatcctgatccaaaatctgaatacaat
gatcagctcatacgagctacaaacatgactgtttctgctttacgttttatgaagaccttc
agggctggttatctagaaccagaggtttttcacctcaatccaaaaaaaagtgacactgag
ctcttcaaaaaattaattcgatttgtgccttcttctctttcttggtttggtgcctacatg
gtcaatgcataccccctagatatgtctcagtacttcaggcttttcaattcaacgcgcctg
cctaaactcaacagagatgagctttatatagatgaaaaggcaaagcatttactggtactg
agaaatgggaatttttatgtatttgatgttattgatagagatggaaatatgctgaagcct
tcagaaatacaagcacacttgaaatacatcctcagtgacaacagtccaaccccagccttc
cctcttgggtatctctccagtgaaaaccgagatacatgggcattgctgagaaagaatcta
ttggacaatggcaatgaagaagctcttcaaaaagtagactctgctgtcttttgtttaagt
ttagatgattttcctgttaaagactttgtgcacttgtcccacactatgttgcacggagat
gctgctaaccgctggtacgacaaatcctttaatcttatcataactaaagatggcaccgct
ggagttaattttgaacattcctggggagacggtgtggctgtgctcagattccagaatgag
gtttttaaagatagcgttggagagccagctgtcagcccccagtcccagcctgcttcagta
gactcttctagagcagtacggagacttgacttcaagctgaatgatgccttaaaagcggga
attaccaaagccaaacagaattttgattctactgtagaagcacttactcttgatatgatt
cagttccaaaaagggggcaaggaccttctaaagcagaagaaggtaagtccagatgctgtg
gctcagcttgccttccagatggctttccttcgacaatacaatcagactgttgctacatat
gaatcttgcagcactgcagctttcaaacatggtcgtacagaaactatacgtcctgcctct
atccatacaaagaaatgttcggaggcttttgtcaaagaaccatccaaacatagcacagaa
gagcttcagaagatgattatggagtgttcagaataccatggccgtttgacaaaagaagct
gctatgggtcagggatttgaccgacatctctttggcttgcgctgcttagccttatccaaa
ggtacttcattacctgatttctaccaagaccaagcctatgctcggcttaatcacaacatc
atttctacaagcacattggttagcccagctgtgcaattaggagggtttggtccagtcgtg
cctgatggctttggagtaggatatcaagtacacggtgattggataggctgcaatgtttcc
tcttacccagctaggaatgcgaaagaattcctccagtgtatatacaagtcactggaagat
atctttaatgttttaaagggcaaaaagataagtagttag

DBGET integrated database retrieval system