KEGG   Apteryx australis mantelli (brown kiwi): 106491399Help
Entry
106491399         CDS       T04298                                 

Definition
(RefSeq) glucosylceramidase-like
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam00511  Other glycan degradation
aam00600  Sphingolipid metabolism
aam01100  Metabolic pathways
aam04142  Lysosome
Brite
KEGG Orthology (KO) [BR:aam00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    106491399
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    106491399
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    106491399
Enzymes [BR:aam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     106491399
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 DUF229
Motif
Other DBs
NCBI-GeneID: 106491399
NCBI-ProteinID: XP_013806454
Position
Un
AA seq 124 aa AA seqDB search
MKTNGAMTGRGTLKGSPGDKYHRTWAQYFIRFLDEYARHNLTFWAVTAGNEPTAGEIVFY
PFQCLGFSPEHQRDFIARDLGPALANSSHRHVQLIILDDQRVMLPYWGRTPGLHPCCRCL
LFLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccaacggggccatgacgggccgcggcacgctcaagggcagccccggggacaag
taccaccggacctgggcgcagtacttcatccgcttcctggacgagtacgccaggcacaac
ctgaccttctgggccgtgacggcggggaacgagcccacggccggcgagatcgtcttctac
cccttccagtgcctgggcttctcccccgagcaccagcgggacttcatcgcgcgggacctg
ggccccgcgctggccaacagctcccaccgccacgtccagctcatcatcctggacgaccag
cgggtgatgctgccctactggggcaggaccccagggctgcacccgtgctgtcgctgcctg
ctgttcctgcactga

DBGET integrated database retrieval system