KEGG   Apteryx mantelli mantelli (brown kiwi): 106491894
Entry
106491894         CDS       T04298                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
aam  Apteryx mantelli mantelli (brown kiwi)
Pathway
aam00230  Purine metabolism
aam00240  Pyrimidine metabolism
aam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aam00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106491894 (DCK)
   00240 Pyrimidine metabolism
    106491894 (DCK)
Enzymes [BR:aam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     106491894 (DCK)
SSDB
Motif
Pfam: dNK AAA_28 AAA_18 AAA_33 Thymidylate_kin DUF5066 AAA_17
Other DBs
NCBI-GeneID: 106491894
NCBI-ProteinID: XP_013807041
Position
Un
AA seq 257 aa
MATPPKRGRLEGSIKKIAVEGNIAAGKSTFVNILKQADEEWEVVPEPVARWCNVQQNAEE
DGEELTTSQKSGGNVLRMMYEKPERWSFTFQTYACLSRIRAQLRSLDGKLREAENPVVFF
ERSVYSDRYIFAANLYESDCMNETEWTIYQDWHDWMNKQFGQSLALDGIIYLRATPEKCL
NRIYLRGRDEEQEIPIEYLEKLHYKHESWLQHRTLRTDFEYLQEIPILTLDVNEDFKGKK
DRYDHMTEKVKEFLSTL
NT seq 774 nt   +upstreamnt  +downstreamnt
atggccactcctcccaagcgcggcaggctggagggcagcatcaagaagatagctgtcgag
ggcaacatcgctgcagggaaatcaacatttgtgaatattctcaaacaagctgatgaagaa
tgggaagttgttcctgagcctgtagcaagatggtgcaatgttcaacaaaatgctgaagag
gatggtgaggagctgactacgtcacagaaaagtggtggaaatgtgcttcggatgatgtat
gagaaaccagagcggtggtctttcactttccagacgtacgcatgcctcagcaggatccgg
gctcagctcagatcccttgacgggaaactccgagaggcagagaatcctgtggtcttcttt
gagcgatctgtctatagtgacagatacatctttgcagctaacttatatgagtctgattgt
atgaatgagactgaatggactatttaccaagactggcatgattggatgaataagcagttc
ggccaaagcctagcgctggatgggatcatttatctcagagctactcctgagaaatgctta
aataggatttacttgcgtggaagagatgaagagcaagaaattcccattgaatatctggag
aagcttcactacaaacacgaaagttggcttcagcatagaacattgcgaactgattttgaa
tacctccaggaaatacctattttaacattagatgttaatgaagacttcaaaggcaaaaag
gacagatatgatcacatgactgaaaaggtcaaagaatttttgagcacgctctaa

DBGET integrated database retrieval system