KEGG   Apteryx australis mantelli (brown kiwi): 106492053Help
Entry
106492053         CDS       T04298                                 

Gene name
GUCY1A3
Definition
(RefSeq) guanylate cyclase 1 soluble subunit alpha
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam00230  Purine metabolism
aam01100  Metabolic pathways
aam04270  Vascular smooth muscle contraction
aam04540  Gap junction
Brite
KEGG Orthology (KO) [BR:aam00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106492053 (GUCY1A3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    106492053 (GUCY1A3)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106492053 (GUCY1A3)
Enzymes [BR:aam01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     106492053 (GUCY1A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Motif
Other DBs
NCBI-GeneID: 106492053
NCBI-ProteinID: XP_013807239
Position
Un
AA seq 688 aa AA seqDB search
MFCTKLKDLKITGECPFSLLTQSHITDEHEKDCTEDSSKAAQPICKEVHEQDAHGNLPQR
KTSRSRVYLHTLTESICKLIFPEFERLNLALQRTLAKHRIKESRNTGDREDFEKIISDHA
NAAGIPVDSLRESLGEELFKICYEEDEHILGVIGGTLKDFLNSFTTLLKQSGHSQEAGKK
DRLEEASILCLEKDQDYLNVYYFFPKKITSLILSGIIKAAAHILYETEVEVMLMPPCFHN
DCTEFVNQPYLLYSIQVKNAKPSLSPCKPESSLVIPASVFCKTFPFHFMFDKDMSVLQIG
NGIRRLLTRREFQAKPNFEEYFEILTPKISCTFSGIMTMLNMQFTVRVRRWDNTDTKSSM
VMDLKGQMIYIFESSAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQARAQ
DGLKKRLGKLKATLEQAHQALEEEKKKTVDLLFSIFPGEVAQQLWQGQVVQAKKFNNVTM
LFSDIVGFTAICSQCSPMQVITMLNELYTRFDYQCGELDVYKVETIGDAYCVAGGLHKES
ETHAVQIALMALKMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNVT
LANKFESCSIPRKINVSPTTYRLLKDYPGFVFTPRSREELPPNFPSNIPGICYFLDAYIQ
GTNSQTWFQKRDFGDGNANFLGEETGID
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgttctgtacaaaactgaaagacttgaagatcacaggggaatgtcctttctccttactg
actcaaagtcacattactgatgaacatgagaaggactgcacagaagacagctccaaagca
gctcagcccatctgcaaagaagtccatgaacaagatgctcatggaaaccttccacaaagg
aaaacaagcagaagcagagtgtatctgcatacattaacggaaagcatctgcaagctaatc
tttcctgagtttgaaaggctaaatcttgcacttcagagaacattagcaaaacacagaata
aaagaaagcagaaacactggggacagagaagattttgaaaaaataatcagtgaccatgct
aatgcagcaggtattcccgtggacagtctaagggaatctcttggtgaagagctattcaaa
atatgctatgaagaggatgaacacatattaggggttattggaggaactcttaaggacttc
ttgaacagttttactactctgctgaagcagagtggccatagccaagaagcaggaaaaaag
gacaggcttgaagaagcctctatattatgcctggagaaagaccaagactacttaaatgtg
tattatttctttcctaagaaaatcacgagtcttatcctatctggcattattaaagcagca
gctcatattttgtatgaaactgaagtagaagtgatgctcatgcctccttgtttccataat
gactgcactgagtttgttaatcagccttatttgctgtactctattcaagttaaaaatgca
aaaccttccttatctccatgtaaaccagagtcttcccttgtgattcctgcctctgtgttc
tgtaagactttcccatttcactttatgtttgacaaggatatgtctgttctacaaattgga
aatgggataagaagacttttgactaggagagaatttcaagcgaagcctaattttgaggag
tattttgaaattcttacccccaaaataagctgcacttttagtggaattatgacaatgctg
aatatgcaatttactgtacgagtgagaagatgggataatactgacacaaaatcatctatg
gttatggatcttaaaggccaaatgatctatatttttgaatccagtgccatcttgttcttg
ggatctccttgtgtggataggctagaagattttacaggacgtggattgtacctctcagat
attccaattcacaatgcactgagagatgttgttctgataggagagcaagccagagctcaa
gacggactgaagaagagattaggaaagctaaaagcaacccttgagcaggcccatcaagca
cttgaagaggaaaagaagaagactgtagatcttctgttctctatttttcctggagaggtt
gctcagcagctgtggcagggacaagttgtgcaagccaagaaatttaataatgtcacaatg
ctcttctctgacattgttggattcactgccatctgttcccagtgttcacctatgcaggtt
atcaccatgcttaatgagctttatactcgctttgattaccagtgtggagagctagatgtc
tacaaggtggagactattggagatgcctactgtgtggcaggaggtttacacaaagaaagt
gaaacccatgctgttcaaatagcattgatggccctgaagatgatggagctgtcagatgag
gtgatgtctccccatggagagcctatcaagatgcgtattggccttcattctggatctgtc
tttgctggagttgttggggttaaaatgccacgttattgcctctttggaaataatgtaacc
cttgccaataaatttgaatcttgcagtataccgagaaaaataaatgtcagcccaaccact
tacaggttgttaaaggactatccaggttttgtgttcacacctcgctcaagagaagaactt
ccaccaaattttcccagcaatatccctggaatttgttattttctggatgcttatattcaa
ggaacaaactcacagacttggtttcaaaagagagattttggagacggcaatgccaatttc
ttgggcgaggaaacaggaatagactaa

DBGET integrated database retrieval system