KEGG   Apteryx australis mantelli (brown kiwi): 106492187Help
Entry
106492187         CDS       T04298                                 

Definition
(RefSeq) monoglyceride lipase-like
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam00561  Glycerolipid metabolism
aam01100  Metabolic pathways
Module
aam_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:aam00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    106492187
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:aam01002]
    106492187
Enzymes [BR:aam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     106492187
Peptidases [BR:aam01002]
 Serine Peptidases
  Family S33
   106492187
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 DLH Peptidase_S9 Abhydrolase_1
Motif
Other DBs
NCBI-GeneID: 106492187
NCBI-ProteinID: XP_013807436
Position
Un
AA seq 99 aa AA seqDB search
MKVSFVIQLMNAIARIERALPKLTLPILVLHGSSDKLCDIRGSYLLMDTVQSQDKTLKVY
EEAYHALHKELPEVTTSVFTEILTWVGQKVSAAGETSHT
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtctcctttgtcatccagctgatgaacgctattgccagaattgagcgagctctg
cccaagctgactctgcctatcctggtgctacacggctcttctgacaagctctgtgatatc
agagggtcctatttactgatggacacagtgcagagtcaggacaaaacactcaaggtgtat
gaggaagcctatcatgccctccacaaagagctgcctgaggtcactacctctgtcttcaca
gaaatactaacgtgggttggccagaaggtctcagcagctggggaaaccagccatacttaa

DBGET integrated database retrieval system