KEGG   Apteryx mantelli mantelli (brown kiwi): 106493927
Entry
106493927         CDS       T04298                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
aam  Apteryx mantelli mantelli (brown kiwi)
Brite
KEGG Orthology (KO) [BR:aam00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:aam03021]
    106493927 (AFF3)
Transcription machinery [BR:aam03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     106493927 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 106493927
NCBI-ProteinID: XP_013809494
Position
Un
AA seq 981 aa
MLIPFVYEPDRNVLRRKEWERRNQEAQQEDGTFNTSYSLFSEPYKTNKGDELSNRIQNTL
GNYDEMKDLLTDRSNQSHLVGVPKPGTPQASLPKPDEHLVTDSRPPPPPSVCSTSSSTPA
ALPAQQNKSTTMGWQKAGHNTASDGQQRASKHGHRSLELHKSDFKLANQKSSLEKLKHYA
SSPTSSSSSNTAQQSSLRSTLGDNVTRVQQQSKLSCGSEGGAQVQERPAKHGGGHCIQNF
PPSLASKPSLVQQKPTAYVRPMDGQDQAPDESPKLKLSAETTKSYREVPSSKPDSARTKS
KITKFSIPKQDEDSGTGDNSCIEEILREMTHSWPPPLSAIHTPGKVEQSKFPFPNKESQQ
GSTGHSNTRKSDVEPKSPEKSTTHTSMLEDDLKLSSDEEENDQQAAQRSALRVLSDSSLV
VPQPNSRAAGFSSKGSSSSSSSESETSSESDSESESSSSESDGSKPSHYSSPEPHGGCSA
FGSINARTSSEIAKELEEQFYXXXPFGRNELLSPLKDSDEVKSLWVKIDLTLLSRIPERL
PEEPLAMSAGASEAASLQQTSSTDPPTEKGLPKSRRKRKCENEEEYRDIKKTHLERESSS
RLAASAHSITTANHCNMNENNLAIPINKNEKMLRSPISPLSDASKHKYSNDDLTSSSRPN
GSSLLPSISSSKKHKGEIQSQPHAGDFNKAIHINSENVLLCNKPQSQTEPWSPLSSTPRD
CRRTKLIFDDMPRNADYFMQEAKRKKHKADAMVEKFGKALNYAEAALSFIECGNAMEQGP
MESKSPYTMYSETVELIRYAVRLKTHSGPNATAEDKQLAALCYRCLALLYWRMFRLKRDH
AVKYSKALIEYFKNSSKAAQTPSPWGASGKSTGTPSPMSPSPSPVSSVGSQGSTGAPSPS
PIISIPQRIHQMAANHVSITNSILHSYDYWEMADNLAKENRDFFNDLDALMGPVTLHSSM
EHLVQYTQQGLHWVRNSAHLS
NT seq 2946 nt   +upstreamnt  +downstreamnt
atgctcatcccatttgtctatgagccggatagaaatgtgctgcgaaggaaagaatgggaa
aggagaaatcaggaagcccagcaggaagatggcacgtttaacacgagttactccctcttc
agtgaaccatacaagactaacaagggggatgagctctcaaatcgcatccagaacacactg
ggcaactatgatgaaatgaaagacttgttaactgaccgatcaaaccagagtcaccttgtt
ggggtcccaaaacctggcactccccaggcctctcttcctaagcctgatgagcatcttgtc
acagactcgagacctccgccgcctccgtctgtttgcagcacttcttcttccacaccagca
gctctacctgcgcagcagaacaaaagcaccacgatgggttggcagaaggccgggcacaac
actgcttcggatggccagcagagagcaagcaagcatgggcacaggtcgctggagttgcac
aagagtgacttcaaactggctaaccaaaaatccagtctggaaaaactaaaacactatgca
tccagtcccacctcctcctcctcctctaacactgcccagcaaagctcgctgaggtccaca
ctaggagacaacgtcaccagagtgcagcagcagtcaaagctaagctgtggttcggaagga
ggagcacaagtgcaagagaggccggcaaaacacggcggcgggcactgcatccaaaacttc
ccaccttcgcttgcttcaaaacccagtctggttcagcagaaaccgacagcttatgtgaga
ccaatggatggtcaagaccaggcccctgacgagtctccaaagctgaagttatcagcagag
acaaccaagtcatatagggaagtgccttctagcaagcctgattcagccaggaccaagtca
aagataacgaagttcagcattcctaagcaagatgaggacagtggaacaggagataacagc
tgcattgaagaaatattgcgggagatgacccattcttggcctccgccactgtcagctatt
catacaccaggcaaggtagagcaaagcaagtttcccttcccgaacaaggagtcacaacag
ggatctacaggacacagcaatacaagaaaaagtgatgtagagccaaagagtccagagaaa
agcacaacccatacatcaatgctagaagatgacctcaagttaagtagcgatgaagaagag
aatgaccagcaggcagcacagagatctgctctccgcgttctatctgacagctccctggtt
gtgccgcagcccaattcccgagccgcaggattctccagcaaggggtcgagcagcagcagt
tccagtgaatccgagaccagctccgagtctgactcagagagcgaaagcagctccagcgag
agtgacggcagcaagccctcgcattattccagcccagagccccacggcggctgcagtgcc
tttggctccattaatgccaggactagtagtgaaatagcaaaggagctggaggaacagttt
tacnnnnnnnnncctttcggtaggaatgagctcctgtctcctctgaaagacagtgatgag
gtaaagtcgctgtgggtcaaaattgatttgactcttttgtccaggattccagagcgcttg
cccgaagagccgctggcaatgagcgccggagcaagcgaggcggccagccttcagcagact
agtagcactgacccccccacagagaagggtctgccgaaatctagaaggaaacgcaagtgt
gagaatgaggaagagtacagagacatcaagaagactcatttagaacgagagagttcttca
cgattagctgcttctgcccatagcatcacaacagcaaatcactgcaatatgaatgaaaat
aacttggcaataccaataaataaaaatgagaaaatgcttcggtcacccatctctcccctc
tctgatgcatcaaaacacaaatactcgaatgatgatttaacttcctccagcagacctaat
ggcagcagtctattaccttccatctcctccagcaaaaaacataagggtgaaatccagtca
cagccacatgccggggacttcaataaagcaattcacatcaattcagaaaatgttcttctc
tgcaataagccacagtcccagacagagccttggtcacctttgtccagcacacccagagac
tgcagaaggacaaagcttatctttgatgatatgccacgcaatgcagattactttatgcag
gaagctaaacggaagaagcataaagcagatgcaatggtggaaaagtttggaaaggcactg
aattatgcagaagcagcactgtcatttattgagtgtggaaatgcaatggaacaaggccca
atggaatctaaatccccttatacaatgtattcagaaacagttgaactcatcaggtatgca
gtgagactaaaaacccactcaggccccaacgccacagcagaagacaaacagctggcagca
ttatgttaccgctgcctggctctactgtactggaggatgttccgactcaagagagaccat
gctgtcaagtactcaaaagcgcttattgagtatttcaagaattcatcaaaagctgcccag
accccatccccttggggtgccagtggaaagagcacaggaactccatcacccatgtcacct
agcccttctccagtcagctctgtaggatcccaggggagcacaggggccccttcaccatct
cctataatcagcatcccgcagcgcattcatcagatggccgccaaccacgtgagcatcacc
aacagcatcctgcacagttatgactactgggagatggctgacaacctggccaaggaaaac
agagatttttttaacgacttggatgcattgatgggacctgtcaccttgcacagcagtatg
gagcatttagttcagtacactcaacaaggacttcactgggtgcggaatagcgctcacttg
tcataa

DBGET integrated database retrieval system