KEGG   Apteryx australis mantelli (brown kiwi): 106494180Help
Entry
106494180         CDS       T04298                                 

Gene name
ABHD12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Brite
KEGG Orthology (KO) [BR:aam00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:aam01002]
    106494180 (ABHD12)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aam04147]
    106494180 (ABHD12)
Enzymes [BR:aam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     106494180 (ABHD12)
Peptidases [BR:aam01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   106494180 (ABHD12)
Exosome [BR:aam04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   106494180 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_3 Abhydrolase_6 Thioesterase Abhydrolase_2 Peptidase_S9 Say1_Mug180
Motif
Other DBs
NCBI-GeneID: 106494180
NCBI-ProteinID: XP_013809849
Position
Un
AA seq 179 aa AA seqDB search
MTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIR
EEARSHPFSVIYRYFPGFDWFFLDPITTSGIKFANDENVKYISCSLLILHAEDDPVVPFH
LGKKLYNIAATSRSFRDYKVQFIPFHTDLGYRHKYIYRSPELPRILREFLGKSEHEHHQ
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgacctacgatgcccttcatgtctttgactggattaaagcaagaagtggagacaaccct
gtctatatatggggacactccttgggcacaggggttgcaacaaatctagtgaggcgcctc
tgcgagagagaaacccccccagatgccctgatactggaatctccgttcaccaacatacgc
gaggaggcacgaagtcaccccttttccgtgatatacagatacttccccgggtttgactgg
ttcttccttgaccccatcacaacaagtggaattaaatttgcaaatgatgagaatgtgaaa
tacatttcctgctccctgcttatccttcatgctgaggatgaccctgtggtaccatttcat
ctgggaaagaagctttacaacattgccgcgacgtcgaggagtttccgagactacaaggtg
cagttcatcccgttccacacagacctcggctaccggcacaagtacatctacaggagtcca
gagctacctcgaatactgcgggaattcctgggaaaatctgaacatgagcatcatcagtga

DBGET integrated database retrieval system