KEGG   Apteryx australis mantelli (brown kiwi): 106495796Help
Entry
106495796         CDS       T04298                                 

Gene name
MAPKAPK2
Definition
(RefSeq) mitogen-activated protein kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam04010  MAPK signaling pathway
aam04218  Cellular senescence
aam04370  VEGF signaling pathway
aam04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:aam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106495796 (MAPKAPK2)
   04370 VEGF signaling pathway
    106495796 (MAPKAPK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    106495796 (MAPKAPK2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106495796 (MAPKAPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aam01001]
    106495796 (MAPKAPK2)
Enzymes [BR:aam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106495796 (MAPKAPK2)
Protein kinases [BR:aam01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   106495796 (MAPKAPK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase
Motif
Other DBs
NCBI-GeneID: 106495796
NCBI-ProteinID: XP_013811799
Position
Un
AA seq 205 aa AA seqDB search
MKKRIRMGQYEFPNPEWSEVSEEVKQLIRNLLKTDPTQRMTITEFMNHPWIMQSMQVPQT
PLHTSRVLKEEKDLWEDVKHLLDAVPLPWILSLPSGDVMRFHLLLRVRQSLSCPHRSPVS
RVLRGGCGAAGMCEPLGTGWSGRSGGSGGDNYFIMIIFTASLAAASSRSAAALGQSRVQR
QKQRVFRAVEPAKPGPGSCWRQEGR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagcgcatccgaatgggccagtatgaatttcccaaccccgagtggtccgaagta
tcagaagaagttaaacagctgatccgcaacctgctgaagacggacccgacccagcgcatg
acgataacggagttcatgaaccacccctggatcatgcaatcgatgcaggtgccccagacc
ccgctgcacaccagtcgcgtgttgaaggaggagaaggatttgtgggaggacgtgaagcac
ctcctggatgctgttcctcttccctggatcctgagcctcccctccggggatgtgatgcgt
ttccacttgctgctccgtgtgcgccagtccctgtcctgcccgcaccggagccccgtcagc
cgcgtgctgcggggagggtgcggagctgctggcatgtgcgagcccctgggcacaggctgg
tcgggacgctccggaggaagtggcggagataactattttatcatgattatttttacggcc
agcctggctgccgctagcagccggagcgctgcggcgctcgggcagagccgggtgcagcgg
cagaagcaacgagtatttcgggccgtggagcccgccaagcccggccccgggagctgctgg
cggcaggaaggaagatga

DBGET integrated database retrieval system