KEGG   Apteryx australis mantelli (brown kiwi): 106496406Help
Entry
106496406         CDS       T04298                                 

Gene name
SLC27A2
Definition
(RefSeq) solute carrier family 27 member 2
  KO
K08746  solute carrier family 27 (fatty acid transporter), member 2 [EC:6.2.1.- 6.2.1.3]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam03320  PPAR signaling pathway
aam04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:aam00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106496406 (SLC27A2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    106496406 (SLC27A2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aam01004]
    106496406 (SLC27A2)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aam02000]
    106496406 (SLC27A2)
Enzymes [BR:aam01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     106496406 (SLC27A2)
    6.2.1.-  
     106496406 (SLC27A2)
Lipid biosynthesis proteins [BR:aam01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   106496406 (SLC27A2)
Transporters [BR:aam02000]
 Solute Carrier Family (SLC)
  SLC27: Fatty acid transporter
   106496406 (SLC27A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 106496406
NCBI-ProteinID: XP_013812499
Position
Un
AA seq 476 aa AA seqDB search
MVRFKQHLLLCAQLPELKESVEEILPFLKEENIKVYYLSRTSVTEGVESFLDKVDAASDE
PTPLSWRSDITFKTPAMYIYTSGTTGLPKAAVINHERIMLACGLFDAGKVTSEDIVYTAL
PLYHSSALLVGVHGCIMKGATIVLRARFSASQFWDDCRKYNVTVIQYIGEVLRYLCSVPQ
RKNDQDHKVRLAIGNGIRTDVWREFIRRFGNISILEFYASTEGNISFVNYTGKIGAVGRV
NYLQKKILRYELIKYDVEKDEPVRDENGYCIRVPKGQPGLLICRITKYAPFSGYAGAKHQ
TEKKQLRDVFQKGDLYFNSGDLLVIDNDDFIYFHDRTGDTFRWKGENVSTTEVADILGLI
DYVQEVTVYGVSVPGYEGRTGMACIRLKENCEFDGENTYRHVHAHLPNYARPRFIRIKST
IELTATFKYRKVQLVEEGFNPAVIKDCLYILDEKENMYVQMTQDIYNSVKKHDFRL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggtgagatttaagcagcacctgctgttgtgtgcgcagttgccggagttgaaggaatct
gttgaagaaatactgccattcttgaaggaagaaaatattaaagtttattacctaagcagg
acatctgttacagaaggagttgagagctttcttgataaagtagatgctgcttcagatgag
cctactccgttgtcttggagatcagatataacctttaaaactcctgccatgtacatttat
acctctggtactacaggtcttcccaaggctgcagtgataaaccatgaacgaataatgcta
gcttgtggtttgtttgatgccggcaaggttacctcagaagatattgtgtatactgctcta
ccactctatcacagctctgccctccttgttggagtccatggatgcatcatgaaaggtgca
actattgttttgcgtgccagattttcagcaagccagttctgggatgactgcaggaaatac
aacgtaacagtgatacaatatattggggaagtgcttcggtatttatgcagtgtgccacag
agaaaaaatgatcaggatcacaaagtcagacttgccataggaaatgggataaggactgat
gtttggagggaatttatccgaagatttggaaatattagtattctagagttttatgcttca
actgaggggaacatttcctttgttaattacactggaaaaattggtgcagtgggaagagtg
aactacttacagaagaaaatcttacgctatgaactgattaaatatgacgtagagaaagat
gaaccagtccgagatgagaatggatactgcataagagttcccaaaggtcagccaggactc
ctgatctgcagaatcaccaaatatgcaccatttagtggctatgcaggagcaaaacaccaa
acagagaagaagcaattaagagatgtcttccagaaaggggatttatattttaatagtggt
gaccttttagtgattgacaatgatgacttcatttatttccatgatagaactggagacaca
ttccggtggaaaggggaaaacgtttctacaactgaagttgcagacattttaggattgatt
gactacgttcaagaagttactgtatatggagtatctgttccaggttatgaaggcagaaca
ggaatggcatgtattcgactgaaggaaaactgtgaatttgatggtgaaaatacttacaga
catgttcacgctcaccttccgaactatgcaagacctcgttttataaggatcaagagcacc
attgaactcacagcaacttttaagtaccgtaaagtacaactagtggaggagggtttcaat
ccagcagtcatcaaagattgcctgtatatcctggatgaaaaagaaaatatgtatgtacaa
atgacccaggacatttataactcagtaaaaaaacatgacttcagattgtaa

DBGET integrated database retrieval system