KEGG   Apteryx mantelli mantelli (brown kiwi): 106496969
Entry
106496969         CDS       T04298                                 

Gene name
AHRR
Definition
(RefSeq) aryl-hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
aam  Apteryx mantelli mantelli (brown kiwi)
Brite
KEGG Orthology (KO) [BR:aam00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aam03000]
    106496969 (AHRR)
Transcription factors [BR:aam03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    106496969 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_11 PAS_9
Other DBs
NCBI-GeneID: 106496969
NCBI-ProteinID: XP_013813191
Position
Un
AA seq 756 aa
MIPPGDCLYAGRKRRKPIQKQRPAVGNEKSNPSKRHRDRLNAELDHLASLLPFPSDIISK
LDKLSVLRLSVSYLRVKSFFQAIQEKHFKKQGDQTIKEDNISNKTAVQEGGLLLESLNGF
ALVVSADGMIFYASSTIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMNPPQMLS
GQQTETGEEYILSKLFKAQENDSMTTDYSSFLTRCFICRVRCLLDSTSGFLTMQFQGKLK
FLFGQRKKSSSGTVLPPQLSLFCIVVPLLLPSMTEMKMKSLLVKAKHKADDTAGVNTNCS
SKANSGLCEAAELYGRNSHHEGAAFPNVLQSAENQIKARNNGENGISLAKVQTNEDHWVW
VQANTQLLYRSGYSEYVLAQQQMLKEEDKQLKIPSSFATLKGNLEGLSYNSAIETLGQLK
HLNWTAVKKEQVNVKVKFEPNTDDECFMLEEPLSSNTSVLGVQNNCTTNSSWNLRNSNSC
SINQRMNTCSNRRVGSFYNRDQSFLSFTSTCPSYWGSAESCQSYSDLQQQSMENCPTDHL
KLQRSLISSESPCDAVFPLDMPIKTEYDSDSENIADNYLTSQNRAWLDENGTVRKQLFSY
PNIVHLKTEPDLCEQVSPCQKPRHCVYTPHNWQCIVTNHPNNLNLNRSCKGLWSKEMAPF
CPPNSACLESLPDLSHIESYHQFYSPNSVEEKEQNNEIFKMQCKIKNPCLVQAIKCEPLD
SPPLSNNGQNVVHTSFSENTLAGPVPHKTTECTFLQ
NT seq 2271 nt   +upstreamnt  +downstreamnt
atgattcctccaggggattgcctatatgctgggagaaaaaggaggaaacccattcagaaa
caaaggcctgcagttgggaatgaaaaatctaatccttcaaagagacacagggaccgtctg
aatgcggaactcgaccatctggccagcctcctgccttttccatctgacattatatctaag
ctggacaaactttctgtgttgcgccttagtgtcagctatctccgagtgaaaagtttcttt
caagccattcaagaaaagcactttaagaagcaaggtgatcaaacaataaaggaagacaat
atatctaacaagactgctgtacaagaaggtggacttctactagaatcactgaatggtttt
gcactggtggtgagtgcagatggaatgatattttatgcatcatcaactattgtggactat
ctaggctttcatcagactgatgtaatgcaccaaaacatatatgattacattcatgtggat
gatcgccaggatttctgtagacaactacactgggccatgaaccctccccagatgttatct
ggacagcagacagaaacaggagaagaatacattctcagtaaattgtttaaagcacaagag
aatgacagcatgacaacagattattcttccttcttaactcgttgtttcatctgtcgagtt
cggtgcttgttggatagtacttctggcttccttacaatgcagtttcaaggcaaactaaag
tttctttttggacaaaggaagaagtcctcatcaggaacagtattaccgcctcagttgtca
ttattctgcatagtggtaccacttcttctcccttctatgacagagatgaagatgaaaagc
ctgcttgtgaaagcaaaacacaaagctgatgatacagcaggagtgaatacaaactgcagt
tcaaaagctaattcaggtctgtgtgaagcagcagaattatatggaagaaacagtcatcat
gaaggtgcagctttccctaatgtgttacagagtgctgaaaaccaaatcaaagcaaggaat
aatggagaaaatggcatttctctagccaaagtacaaacaaatgaagatcactgggtctgg
gttcaagctaacactcagcttctgtatcgaagtggttattcagagtatgtccttgcccaa
cagcaaatgttgaaggaagaagataagcaactgaagataccgagcagttttgccactttg
aaaggaaacctggaaggactttcttataacagtgccattgaaactctgggccaattgaag
catcttaactggacagcagtaaaaaaggaacaagttaatgtaaaagtgaagtttgaacct
aatacagatgatgagtgttttatgttagaggaacctctcagttctaatacatcagtttta
ggtgttcaaaacaactgcaccacaaacagcagctggaatctaagaaactcaaactcttgt
tctataaatcaacgaatgaatacatgttcaaacagaagagttggatcattctataacagg
gaccaaagtttcttaagtttcacatcaacttgcccttcctactgggggagtgcagaaagc
tgccagtcttactcagacttacaacaacaatctatggagaactgtcctacagatcatctg
aaattacagagatcattaatatcctcagagtctccctgtgatgcagtctttccattggat
atgcctatcaaaacagagtatgattctgattctgaaaacattgctgataactacttgaca
tcacaaaatagagcctggttggatgagaatggcacagtgagaaagcagctgtttagttat
cccaatatagtgcaccttaaaacagaaccagacctctgtgaacaagtttcaccttgtcag
aaaccaaggcactgtgtttatacaccacataattggcaatgcattgtaacaaatcatccc
aacaacctaaatctgaacagatcttgcaagggcttatggagcaaggagatggctccattt
tgccctccgaactctgcgtgtttggaaagcttgcccgacttatcacatattgaaagctac
catcagttctatagcccaaattcagtggaagagaaagagcagaataatgagatttttaaa
atgcaatgcaaaatcaaaaatccctgcttggttcaagcaatcaagtgtgagcccctggat
tctccaccattgtccaataatggacagaatgtagtacatacgagcttctctgaaaataca
ttagcaggtcctgtgcctcataaaacaactgaatgtacatttttacagtag

DBGET integrated database retrieval system