KEGG   Apteryx australis mantelli (brown kiwi): 106498151Help
Entry
106498151         CDS       T04298                                 

Definition
(RefSeq) cytosolic phospholipase A2 epsilon-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam00564  Glycerophospholipid metabolism
aam00565  Ether lipid metabolism
aam00590  Arachidonic acid metabolism
aam00591  Linoleic acid metabolism
aam00592  alpha-Linolenic acid metabolism
aam01100  Metabolic pathways
aam04010  MAPK signaling pathway
aam04217  Necroptosis
aam04270  Vascular smooth muscle contraction
aam04370  VEGF signaling pathway
aam04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:aam00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    106498151
   00565 Ether lipid metabolism
    106498151
   00590 Arachidonic acid metabolism
    106498151
   00591 Linoleic acid metabolism
    106498151
   00592 alpha-Linolenic acid metabolism
    106498151
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106498151
   04370 VEGF signaling pathway
    106498151
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    106498151
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    106498151
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106498151
Enzymes [BR:aam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     106498151
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 106498151
NCBI-ProteinID: XP_013814746
Position
Un
AA seq 808 aa AA seqDB search
MGSHWSAHENEECPCSSLSVKIVRMRNLRKADLFSQTDCYVSLSLPTASSETVRTKTIKN
CKDPVWNETFCFRIQSQVKNILEMKVYDENAVTEDDLLFTVLFDVAKIQLGETVHLTFQL
NPQTQEVLEVEFASESIPVPPEKLVNNGVLVSREISCMEVQVDSRWMKKEASEKDFLFAV
KGSYEERQKLSLRSPLKSAEPIVFHYVKYSQSELCIAVPEKKSHFCLCPSGEEKRDCNAT
LTIPLDSLPFKEKVAVAKDETINLHVKSNDWTKKLDVRLAFDLCTEEKNFLQKRKKFVAS
ALKKALHLEQELQDHEVPVVAVMTTGGGTRALTSLLGNLLGLQKLDLLDAISYITGSSGS
TWTLSHLYQSTDWSRKDLSGPISEVRRHMTKCKLSCFSLESFKYYDKELKLRKQKGYQIS
SIDLWGLLLEKALNDGKNDHKLSDERQALDQGQNPLPIYMILNIKEDYSLAEFKEWVEFT
PYEVGFLKYGAFIRVEDFGSDFFMGHLMKKLPESRICFMQGLWSNVFSYNLLDAWHSSDP
SERFSLRCTQPRAVDVGEQEPFLPARNNELETYLVTPECGIMGIVRQFLTERVMVSKFFN
FLKGFQMHNEYLQSKSFCIWKDTVLDNFPNQLTQTAEFLCLADTAGYIDISYPPLMRPER
KVDVVLHLNYSSGSQTSPLEEASQYFLRQGIPFPKVHLSDEEKKNLKECYIFEDRETPEA
PIVVFFPLVNDTFRKYEEPGVERSPAEMAQGNVDVSSLFSPYCINSFTYTEEEFDKLVKL
TSYNIQNNKHLILQALNSAVEEKKQQKK
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgggctcacactggagtgctcatgagaatgaagaatgtccatgcagctccctctctgta
aaaattgtaagaatgagaaatctgagaaaggcagatctgtttagtcaaactgattgctat
gtaagcctctccttgcccactgcttcctctgagactgtccggaccaaaaccatcaagaac
tgcaaagatccagtgtggaatgaaacattttgcttcaggatccagagccaagtaaaaaac
atcctggagatgaaagtctatgatgaaaatgcagtcactgaagatgaccttctcttcact
gtcctctttgacgtagctaaaatccagcttggagaaactgttcacttgacttttcagcta
aatccacagacacaagaggtgctggaggtggagtttgcatcagagagcattccggttcct
cctgaaaagcttgtcaataatggtgtattagtgtctcgtgaaatttcctgcatggaagtc
caggtggacagtagatggatgaagaaagaagcttcagaaaaagacttcttatttgcagtg
aaaggatcctatgaagagaggcagaaactttcactgcgctctcccctcaagtccgcagag
cccattgtgttccattatgtcaagtacagtcaatcagaactatgcattgcagtaccagaa
aaaaagtcacatttctgcttgtgtccgtcaggtgaagagaaaagagactgcaatgcaacc
cttactattcctctggattcacttcccttcaaggagaaagtagcagtagccaaggatgaa
acaatcaatttacatgtgaagtcaaatgactggacaaaaaaattagatgttcgcttggca
tttgatctatgtacggaggaaaaaaatttcctacagaaacggaagaagtttgtggcttct
gctctgaaaaaagcccttcatttagagcaagagctacaggaccacgaggtaccagttgta
gcagtcatgacaacagggggtggcacccgggcactgacatctttgttaggcaacctgctg
ggccttcagaagctggatctcttagatgctatttcatacatcactgggtcatctggctca
acatggaccttgtcgcatttgtatcagagcactgactggtcacgcaaggatctgtctgga
ccgattagtgaagtccggaggcacatgaccaagtgcaagctgagttgcttttccttggaa
agctttaagtactatgacaaggaattaaagctgcggaagcaaaagggataccagatctct
agcattgatttgtgggggcttctactggaaaaagcattaaatgatgggaaaaatgaccat
aaactttcagatgagcgacaggcattggatcagggtcagaatcctctacctatctacatg
atcctcaacatcaaagaagattacagccttgcagagtttaaagaatgggtggagttcacc
ccttatgaggtgggattcttaaaatatggagccttcattcgtgtagaggattttggcagt
gacttcttcatgggtcatctgatgaagaagctccctgaatcaaggatctgcttcatgcaa
ggcctgtggagcaatgtcttctcctataacctgttggatgcctggcattcgtcagatcct
tcggaaagattctcactgaggtgcacccaacccagagctgttgatgttggagaacaagag
ccttttctaccagcaaggaacaatgagttggagacttacttggtgacccctgaatgtggc
atcatgggtattgttcgacagttcttgacagagagggtgatggtttcaaagttcttcaac
ttcctaaagggattccagatgcacaatgaatacctacagagcaaaagcttttgtatatgg
aaagataccgtactagacaatttccccaaccagttgacacaaacagcagagtttctgtgc
ctagcagacacagctggatacatcgatatcagctacccaccactcatgaggccagagagg
aaagtggatgttgtcctacacttaaactattcttctggatcacagacgtcgcctttggaa
gaagcctctcagtacttcttaaggcagggaatcccgtttcccaaagttcacctgagtgac
gaagagaagaagaacctaaaggagtgttatatctttgaagacagggagacccccgaggcg
cctattgtggtatttttcccgctggtgaatgacacgttcaggaagtacgaagagccgggg
gtggaacgcagcccggctgagatggcccagggtaacgtggacgtttccagccttttctct
ccttactgtataaacagctttacctacacagaggaggaatttgacaagctggtaaaactg
accagctacaacattcagaacaacaaacatttgattcttcaggctttgaattcagcagta
gaagagaaaaaacaacagaaaaaataa

DBGET integrated database retrieval system