KEGG   Apteryx australis mantelli (brown kiwi): 106498626Help
Entry
106498626         CDS       T04298                                 

Gene name
SUCLG1
Definition
(RefSeq) succinate-CoA ligase alpha subunit
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam00020  Citrate cycle (TCA cycle)
aam00640  Propanoate metabolism
aam01100  Metabolic pathways
aam01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106498626 (SUCLG1)
   00640 Propanoate metabolism
    106498626 (SUCLG1)
Enzymes [BR:aam01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     106498626 (SUCLG1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     106498626 (SUCLG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ligase_CoA Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 106498626
NCBI-ProteinID: XP_013815338
Position
Un
AA seq 210 aa AA seqDB search
MPLIVCITEGIPQQDMVRVKHRLLRQDKTRLVGPNCPGVINPGECKIGIMPGHIHKKGRI
GIVSRSGTLTYEAVHQTTQVGLGQSFCVGIGGDPFNGTNFIDCLDVFLKDPHTEGIILIG
EIGGNAEEDAATFLKENNSGPNAKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKIA
ALQSAGVVVSMSPAQLGSTMYKEFEKRKLL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgccattaattgtatgcattactgaaggtattccccagcaggacatggttcgggttaaa
catagactgcttcgacaagataagactcgactagtgggcccaaattgccctggagtcatc
aatcctggagaatgtaaaattggtatcatgcctggtcacattcacaagaagggaagaatt
ggtattgtgtcaagatctggcaccctgacatatgaagctgttcatcagacaacgcaagtt
ggattagggcagtctttctgcgttgggatcggaggagatcccttcaatggaactaatttt
attgactgccttgatgtcttcctgaaggatcctcatactgaaggtatcatattgattgga
gaaattggaggaaatgctgaagaagatgcagcaacattcttgaaagaaaataattctggt
ccaaacgccaagccggtagtgtccttcatagctgggctgactgctcctccaggcaggcgg
atgggtcatgctggagccatcattgctggggggaagggtggagctaaagagaagatagct
gctcttcaaagcgctggtgttgtggtcagcatgtctcctgctcagctaggtagcaccatg
tacaaggagtttgagaagaggaaattgctgtaa

DBGET integrated database retrieval system