KEGG   Apteryx mantelli mantelli (brown kiwi): 106499357
Entry
106499357         CDS       T04298                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1-like
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
aam  Apteryx mantelli mantelli (brown kiwi)
Brite
KEGG Orthology (KO) [BR:aam00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aam01002]
    106499357
Enzymes [BR:aam01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     106499357
Peptidases and inhibitors [BR:aam01002]
 Metallo peptidases
  Family M1
   106499357
SSDB
Motif
Pfam: Peptidase_M1 Peptidase_M1_N
Other DBs
NCBI-GeneID: 106499357
NCBI-ProteinID: XP_013816282
Position
Un
AA seq 562 aa
FSASADQDGGNNMQFPWDKMRLPRHVIPVHYDLLIHPNLTTLTFSGSAKIEITVTQQTSS
VILHSKRLHITKAAIEAGAGGARSVQEVQVLEHQPFEQVALLAAEPLHPGHSYTVSISYS
ANLSESFHGFYKSTYRTQNGELRVLASTQFEPTAARMAFPCFDEPAFKARFSIKIRREPK
HLALSNMPIVKTVNITSWLVEDHFDTSVKMSTYLVAFIVSDFKSVSKITSHGIKISVYTV
PDKINQAVYALDAAVKLLDFYEDYFSIPYPLPKQDLAAIPDFQSGAMENWGLTTYRESAL
LYDPEKSSASSKLWTTMIIAHELAHQWFGNLVTMEWWNDLWLNEGFAKFMEFVSVSITHP
ELRVEDYFLGKCLDAMEVDALNSSHPVSTPVEDPAQILEMFDDVSYEKGSCILNMLRDYM
TADVFKAGLVQYLQKYSYQNTKNEDLWNSMTNICPTVDTDENELQGDNFCRRNQLSSSSA
HWTKRETLDVRAMMNTWTLQKGFPLVTVTVRGKNVHLQQEHYMKGVDSPSSTEYLWHIPL
TYITSKSDTVQRFLMTTKIGEM
NT seq 1689 nt   +upstreamnt  +downstreamnt
ttttctgcgagcgctgaccaagatggtggtaacaacatgcagtttccttgggacaaaatg
aggctccccaggcacgttatcccagtgcattacgatctcctcatccatcctaatctcacc
actctgacattttccgggtccgctaaaatagaaattacagtcacccagcaaaccagttca
gtcatcctgcacagcaaacgcctgcacatcaccaaggctgccatcgaggctggggccggg
ggtgcccgctcggtgcaagaggtgcaggttttggagcaccagcccttcgagcaggtggcg
ctccttgctgctgaaccactgcaccccggacacagctacacggtcagcatctcctactct
gcaaatctctccgagtctttccacggcttttataaaagcacctacagaacccagaatgga
gaactcagagtacttgcctcaacacagtttgagccgacagctgcacgaatggccttccca
tgttttgatgaaccagccttcaaagccagattttcaattaagattaggagggaaccaaag
caccttgcactatccaatatgccaattgtgaaaactgtgaatataacttcgtggcttgtt
gaggaccattttgatacaagtgtcaagatgagtacttaccttgtggcctttattgtttca
gattttaaatctgtcagcaaaataaccagtcatggaattaagatttctgtatacacagta
ccagacaagatcaaccaagctgtttatgcattggatgcagcagtgaaacttttagatttc
tatgaggattactttagcattccatatcctttgcctaaacaagatttagcagctattcct
gattttcagtctggtgctatggaaaactggggattgactacataccgggaatctgcattg
ttgtatgaccctgaaaagtcctcggcatcctctaaactttggactactatgataatagcc
catgaactggctcatcagtggtttggcaacctagttactatggagtggtggaatgatctc
tggttaaacgaagggtttgcaaagtttatggagttcgtgtcggtcagcattacccaccca
gaactgagagttgaagattatttcttaggcaaatgtcttgatgccatggaagtggatgca
ttaaattcatcgcatcctgtgtctactcctgtggaagatccagctcaaattttagaaatg
tttgatgatgtttcttatgaaaagggatcttgtatattaaatatgctgagggactacatg
actgctgatgtgtttaaagctggacttgtgcagtatctgcagaaatacagctatcagaat
acaaaaaatgaagatttgtggaacagtatgacaaatatttgccctactgtagatactgat
gaaaatgaactacaaggtgataatttttgcagaagaaaccaactgtcatcttcaagtgca
cactggaccaaaagagagactcttgatgtgagggcaatgatgaacacttggacactgcag
aaaggttttcccctggtaactgtcacagtgagaggaaagaatgtccatctgcagcaggag
cactacatgaagggagtggattctccttcatccacagagtacttgtggcacattccactg
acctacattaccagtaaatctgacactgttcaaagatttttgatgacaactaaaataggt
gaaatgtag

DBGET integrated database retrieval system