KEGG   Apteryx australis mantelli (brown kiwi): 106499698Help
Entry
106499698         CDS       T04298                                 

Gene name
FASLG
Definition
(RefSeq) Fas ligand
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam04010  MAPK signaling pathway
aam04060  Cytokine-cytokine receptor interaction
aam04068  FoxO signaling pathway
aam04210  Apoptosis
aam04217  Necroptosis
aam05164  Influenza A
aam05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:aam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106499698 (FASLG)
   04068 FoxO signaling pathway
    106499698 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106499698 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106499698 (FASLG)
   04217 Necroptosis
    106499698 (FASLG)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    106499698 (FASLG)
   05168 Herpes simplex virus 1 infection
    106499698 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aam04147]
    106499698 (FASLG)
   04052 Cytokines and growth factors [BR:aam04052]
    106499698 (FASLG)
   04090 CD molecules [BR:aam04090]
    106499698 (FASLG)
Exosome [BR:aam04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   106499698 (FASLG)
Cytokines and growth factors [BR:aam04052]
 Cytokines
  Tumor necrosis fators
   106499698 (FASLG)
CD molecules [BR:aam04090]
 Proteins
  106499698 (FASLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF FAM165
Motif
Other DBs
NCBI-GeneID: 106499698
NCBI-ProteinID: XP_013816690
Position
Un
AA seq 294 aa AA seqDB search
MQAYKGRAGSSPRTQSGPAPAPFGCHMEDHTKHVQPIPLPAMQQNLNYVYPQIFWVDGCT
NPSTSCPPASPIAPIPPPVPDRRRKPRSKREGKSIGFLVVSLLILLCLTGVGLSMFQIFR
LEKELAELRESASTEHIPPALEKLIGQKSESVKKEERKAAHLTGNPKQQDLPLEWEPISG
HAFTAGIQYRNQGLVINETGLYFVYSNVLFRGSTCNSQVLTHVVYKRNPVSPGSQVLMED
KKINYCANQKMWARKSYLGALFKLREKDSLHVNVSKIALVNFEESKTFFGLFKL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgtataaaggcagagctgggtcttcccccaggactcagtctgggccagcccca
gcaccttttggctgccacatggaagatcacacaaagcatgtccagcccattccgctccca
gccatgcagcagaacttgaactacgtgtaccctcagatcttttgggtggatggctgtacc
aaccccagcacttcctgtcccccggcatcccccattgcccccatcccaccaccagtacct
gatcggaggagaaagccaaggagcaagagggaagggaagagcatcggcttcctggtggtc
tccttgctgatcctgctgtgtctcactggagttggactgagcatgtttcagatttttcgc
ctagagaaggaactggctgaactcagagagtctgccagcactgaacacatccctccagct
ctggagaagctcatagggcagaagagcgagtcagtgaaaaaggaagagaggaaagcagca
catttaacagggaaccccaagcagcaggacctccctttggagtgggaaccgatctccggg
catgccttcactgccggcattcagtaccgcaatcagggcctggtgatcaatgaaaccggc
ctctacttcgtgtactccaacgtgctcttccggggaagcacctgcaacagccaggtgtta
acccacgttgtctacaagagaaacccagtctccccgggcagccaggtgttgatggaggac
aaaaagatcaactactgtgcaaatcagaagatgtgggcccggaaaagctacctgggggct
ttgttcaagctcagggaaaaggacagcctgcacgtcaacgtttccaaaatcgctctggtt
aattttgaggaatccaagacgttttttggcttatttaaactttaa

DBGET integrated database retrieval system