KEGG   Anoxybacillus amylolyticus: GFC30_2258Help
Entry
GFC30_2258        CDS       T04397                                 

Gene name
mqo
Definition
(GenBank) malate dehydrogenase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
aamy  Anoxybacillus amylolyticus
Pathway
aamy00020  Citrate cycle (TCA cycle)
aamy00620  Pyruvate metabolism
aamy01100  Metabolic pathways
aamy01110  Biosynthesis of secondary metabolites
aamy01120  Microbial metabolism in diverse environments
aamy01130  Biosynthesis of antibiotics
aamy01200  Carbon metabolism
Module
aamy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aamy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aamy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GFC30_2258 (mqo)
   00620 Pyruvate metabolism
    GFC30_2258 (mqo)
Enzymes [BR:aamy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     GFC30_2258 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 PHF12_MRG_bd
Motif
Other DBs
NCBI-ProteinID: ANB60256
UniProt: A0A160F221
Position
complement(2178709..2180214)
Genome map
AA seq 501 aa AA seqDB search
MVSKQTKTDVILIGAGIMSATLGTLLKELAPGWDITVFERLGQPADESSNEWNNAGTGHA
ALCELNYTVEKPDGSIDVSKAIKINEQFHESLQFWSYLVQNNRIRNPKEFIMPLPHMSFV
QGEENVTFLKKRFDALANNPLFQGMEFSDDPQKLKEWIPLMMEDRIVTEPIAATKIESGT
DVNFGALTRMLFDYLAKKGVDIRYKHHVDDMKRTSDGLWELKVRHLVSGEVEHYVAKFVF
IGAGGGSLHLLQKSGIPEGKGIGGFPVSGLFMVCNNPAVAEQHHAKVYGKAKVGAPPMSV
PHLDTRFIDNKKMLLFGPFAGFSPKFLKNGSLLDLITSVKPHNLLTMLAAGAKNMPLTKY
LIEQVMLSKEQRMEELREFIPNAKSEDWDLVVAGQRVQVIKDTPAGGKGTLQFGTEVVAA
HDGSVAALLGASPGASTAVHVMLEVMEKCFPEQMKAWEPKIKEMIPSYGVSLMKNETLLR
DVQALAARTLGLKETVALELV
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggtgagcaaacaaacgaaaacagatgtcattttaattggtgccgggattatgagtgca
acgttagggacattgctgaaagaattagcgccgggatgggacattactgtctttgaaaga
ctagggcaaccagcagatgaaagttcaaacgaatggaataatgccggaacgggtcatgcc
gcactttgtgaactaaactacacagtcgaaaaaccggacggatcgatcgatgtaagcaaa
gcgattaaaattaacgaacagtttcacgagtcgttgcagttttggtcatatcttgtgcaa
aacaaccgcattcgcaacccaaaagaatttattatgccccttccgcatatgagctttgtg
caaggggaagaaaatgtcacgtttttaaagaaacggtttgacgcattggcaaacaatccg
ttatttcaaggaatggaattttccgatgatccacaaaaactaaaagagtggattccactg
atgatggaagaccgcatcgtaacagaaccgattgccgcgacaaaaatcgaatcaggcaca
gacgtcaacttcggtgcgttaacgcgcatgttgtttgactacttagcgaaaaaaggggtc
gatattcgatacaaacatcatgtggacgacatgaaacggacaagcgatggtttatgggaa
ctgaaagtgcgccatttagtgagcggggaagtcgaacattatgtagcgaaattcgtcttt
atcggtgctggcggtggaagtttgcatttactgcaaaaatccggcattcctgaagggaaa
gggatcggcggcttcccggtgagcggactatttatggtctgtaataatccagcagtcgcc
gaacaacatcatgcgaaagtttacggcaaagcgaaagtcggcgcaccgccaatgtccgtt
ccgcatttggatacgcggtttattgataacaaaaaaatgctattatttggcccgtttgcc
ggcttttcgccaaagtttttaaagaacggttcactgcttgacttaattacgtccgtcaag
ccgcataaccttttgacgatgcttgcagccggcgcgaaaaatatgccgttgacgaaatat
ttaattgagcaagtgatgttatcgaaagaacagcgcatggaagaattgcgcgaatttatt
ccgaacgcaaaaagcgaagattgggatttagttgtcgcagggcagcgtgtgcaagtcatt
aaagatacaccagcaggaggaaaaggcacgcttcaatttgggacagaagtcgttgctgca
cacgatggttccgtcgctgctttgcttggcgcgtccccaggcgcttcgaccgctgtgcac
gtcatgcttgaagtgatggaaaaatgcttcccagaacaaatgaaagcatgggaaccgaaa
attaaagaaatgattccttcatacggcgtgtcgctcatgaaaaacgaaacgcttttacgc
gacgtccaagcgcttgccgcgcgaacgcttggcttaaaagaaaccgtggcgctagaactt
gtttaa

DBGET integrated database retrieval system