KEGG   Anoxybacillus amylolyticus: GFC30_331Help
Entry
GFC30_331         CDS       T04397                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aamy  Anoxybacillus amylolyticus
Pathway
aamy00071  Fatty acid degradation
aamy00072  Synthesis and degradation of ketone bodies
aamy00280  Valine, leucine and isoleucine degradation
aamy00310  Lysine degradation
aamy00362  Benzoate degradation
aamy00380  Tryptophan metabolism
aamy00620  Pyruvate metabolism
aamy00630  Glyoxylate and dicarboxylate metabolism
aamy00640  Propanoate metabolism
aamy00650  Butanoate metabolism
aamy00900  Terpenoid backbone biosynthesis
aamy01100  Metabolic pathways
aamy01110  Biosynthesis of secondary metabolites
aamy01120  Microbial metabolism in diverse environments
aamy01130  Biosynthesis of antibiotics
aamy01200  Carbon metabolism
aamy01212  Fatty acid metabolism
aamy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aamy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GFC30_331
   00630 Glyoxylate and dicarboxylate metabolism
    GFC30_331
   00640 Propanoate metabolism
    GFC30_331
   00650 Butanoate metabolism
    GFC30_331
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GFC30_331
   00072 Synthesis and degradation of ketone bodies
    GFC30_331
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GFC30_331
   00310 Lysine degradation
    GFC30_331
   00380 Tryptophan metabolism
    GFC30_331
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GFC30_331
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GFC30_331
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GFC30_331
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aamy04147]
    GFC30_331
Enzymes [BR:aamy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GFC30_331
Exosome [BR:aamy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GFC30_331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: ANB60524
UniProt: A0A167TFT3
Position
321464..322648
Genome map
AA seq 394 aa AA seqDB search
MMGKTVILSGVRTPFGKFGGGLSTFTAAQLGGIAVKEALSRANVSAEQVDEVILGTVLQG
GQGQLPSRQAARYAGIPWEVRTETINKVCASGMRSVTLADQIIRAGDGEVIVAGGMESMS
NAPYVLPKARWGLRMGDSTVKDLMVYDGLTCSFTGVHMGIYGGETAKELEISREAQDAWA
YRSHQRAIAAIEAGVFAEEIVPVEIPQRKGEPLIVTDDESPRKDTSLEKLAKLSPVFDPI
GTITAGNAPGVNDGAAALVLMSEERALREGRTPLATIVAHASIAVEAKDFPKTPGIVINE
LLRKTGKTAADIDLFEINEAFAAVALASIHIAGLDPEKVNVNGGAVALGHPIGASGARII
ITLIHELKRRGGGLGIAAICSGGGQGDAIMVQVD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgatggggaaaacggtcattttaagcggagtacgcacaccatttgggaaatttggtgga
ggtttaagtacgtttactgctgctcagttaggagggattgcagtaaaagaagcgttatcg
cgtgcaaatgtaagcgctgaacaagtagacgaagtgattttaggcacggttctgcaaggg
ggacaagggcagcttccttcccggcaagccgctcgctacgccggaattccatgggaagtg
cgtacagaaacgatcaacaaagtatgtgcttctgggatgcgtagtgtcacattagcagac
caaattattcgtgcaggtgacggggaagtaatcgtggctggcggaatggagtcgatgagc
aatgcgccgtatgtgttgccgaaagcacgctggggattgcgcatgggcgattcgacggtc
aaagatttaatggtatatgacggattaacgtgcagctttactggggtgcatatgggcatt
tacggcggggaaaccgcaaaagaactagaaatttcccgcgaagcgcaagacgcgtgggca
tatcggagccatcagcgggcgatcgctgcgatcgaggcaggggtgtttgccgaagaaatt
gtcccagtcgaaattccgcaacgaaaaggcgaaccgctcattgtaacagacgatgaatcg
ccacgcaaagacacatcgcttgagaaattagcgaagctctccccagtattcgatccgata
ggaacaattactgcgggaaacgctccgggtgttaatgatggggcagctgcgcttgtgcta
atgagcgaagagcgggcgctacgcgaaggaagaacaccgctcgcaacgattgtcgctcac
gcatcgattgcggtcgaagcaaaagacttcccaaaaacaccagggattgtcattaacgag
ctattacggaaaacgggaaaaacagcggcagatattgatttgtttgaaattaacgaagcg
ttcgccgcagtcgcactcgcgagcatccacattgcagggcttgatccagagaaagtgaac
gtcaacggcggagcagttgcgctaggacacccaatcggcgcaagcggtgcacgcatcatt
atcacgctcattcacgaattaaaacgccgcggcggagggcttggcatcgcagcgatttgt
agcggtggtggtcaaggcgatgccatcatggttcaagtcgattaa

DBGET integrated database retrieval system