KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_02159Help
Entry
D7S_02159         CDS       T02046                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
aan00020  Citrate cycle (TCA cycle)
aan00310  Lysine degradation
aan01100  Metabolic pathways
aan01110  Biosynthesis of secondary metabolites
aan01120  Microbial metabolism in diverse environments
aan01130  Biosynthesis of antibiotics
aan01200  Carbon metabolism
Module
aan_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aan00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    D7S_02159
  Amino acid metabolism
   00310 Lysine degradation
    D7S_02159
Enzymes [BR:aan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     D7S_02159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AFI87869
Position
2040950..2042173
Genome map
AA seq 407 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKKAGDAVKRDEVIVEIETDKVVLEVPAQADGVLAQIL
QEEGATVVSKQLLGTLEDSVTAAAIATEKTAEPTPKDRRTEVPDEPHVTDAQGPAVRRLL
AEHGLQPSDVADVKGTGVGGRITREDVEAILAQRTAAAAQPQVAEDTLSTVAYAARSEKR
VPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMQPIMNLRKQYGEKFEKQHGVRLGFMSFY
IKAVVEALKRYPEVNASIDGDDVIYHNYFDVSIAVSTPRGLVTPVLRDCDNLSMADIEKS
IKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKERPVAL
NGQVVIRPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLEI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgacgattgaaattcttgtccccgatttacccgaatccgtagccgatgctaccgtggcg
acttggcacaaaaaagcgggcgacgcagtgaaacgtgatgaagtgattgtggaaatcgag
accgacaaagtggtgcttgaagtgccggcacaggcggacggcgtgcttgcccagattttg
caggaagaaggggcaacggtggtcagtaaacagttgcttggtactctggaagattcagtg
acggcggcagccattgcaacggaaaaaacggcggagccgacaccgaaagatcgtcgcacg
gaagtgcctgatgaaccgcatgtcaccgatgcgcaaggcccggcggtgcgtcgtttatta
gccgagcacggtttacagccttccgatgttgccgatgtaaaaggcaccggcgtgggcggc
agaattacccgtgaagatgtggaagcgatccttgcccaacgcacggctgcagcggcacaa
ccgcaagtggcggaagataccctcagcaccgtggcgtatgccgcgcgtagcgaaaaacgc
gtaccaatgacccgtttacgtaagcgtattgcggaacgcctgttggaagccaaaaacacc
accgctatgttgactacgttcaatgaagtggatatgcagccgatcatgaacctgcgtaaa
caatacggcgaaaaatttgaaaaacaacacggcgtgcgtttaggtttcatgtctttttat
atcaaagccgtggtggaagccttaaaacgttatccggaagtgaacgcttccattgacggc
gacgatgtgatttatcacaactattttgacgtgagcattgcggtttcgactccacgcggt
ttagtgacgccggtattgcgcgattgcgacaatctttccatggcggacattgaaaaatcc
atcaaagccctggcggaaaaagggcgtgatggcaaattgacggtggaagatttaaccggc
ggtaacttcaccattaccaacggcggcgtgttcggttcattaatgtccactccgattatc
aacccgccgcaaagtgccattttaggtatgcacgccattaaagagcgtccggtggcgcta
aacggtcaagtagtgattcgcccgatgatgtatttggcattgagttacgaccaccgctta
attgacgggcgggaatccgtcggtttcttagtgacgataaaagagctactggaagacccg
acaagattattacttgaaatttaa

DBGET integrated database retrieval system