KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_02495Help
Entry
D7S_02495         CDS       T02046                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Brite
KEGG Orthology (KO) [BR:aan00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aan03016]
    D7S_02495
Enzymes [BR:aan01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     D7S_02495
Transfer RNA biogenesis [BR:aan03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    D7S_02495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 RsbRD_N
Motif
Other DBs
NCBI-ProteinID: ANN81579
Position
complement(131409..132122)
Genome map
AA seq 237 aa AA seqDB search
MNLAILYQDDVLVAVNKPAGMLVHRSWLDRHETQFVMQILRDQIGQLVYPIHRLDRPTSG
VLLFALNSETANLVCHQFEQKQTEKQYLAVVRGYVTGQGEIDYPLKVQLDKIADKFAQQD
KAPQSAVTFYDGLKTVEMPYGVGRYAASRYSLVRLTPKTGRKHQLRRHMKHIFHPILGDM
QYGDLHQNRALTEHIGCSRLMLHAEKLTFVHPLTGQPITIEAGLDEQWKHLMRTFQW
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaatttagcgattttgtatcaggatgatgtactggttgcggtgaataagccggcgggc
atgttggtgcatcgcagttggcttgatcgccatgaaacgcaatttgtgatgcaaatcttg
cgcgatcaaatcgggcagttggtgtatcccattcatcgtttggatcgccctacatcaggc
gtattgttgtttgcgttgaacagcgaaacggcaaatttggtatgtcaccaatttgagcaa
aaacaaactgaaaaacagtatttagcagtggttcgtggctatgtgacagggcagggtgaa
attgattatccgttgaaagtgcagttggataaaatcgccgataagttcgcacagcaggat
aaagcaccgcaaagtgcggtcactttttacgacggattgaaaaccgttgaaatgccttat
ggcgtggggcgttatgccgcttctcgctattcgttggttcgcttaacgccgaaaactggg
cgcaagcaccagcttcgccgtcacatgaaacatatttttcatccgattttaggtgatatg
caatacggcgatttgcatcaaaatcgcgctttaacggaacacatcggttgttcccgttta
atgttacacgccgaaaaattaacctttgttcacccgctgacaggacaaccgataaccatt
gaagcgggattggatgagcaatggaaacatttaatgcggacatttcagtggtaa

DBGET integrated database retrieval system