KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_0412Help
Entry
ANH9381_0412      CDS       T01651                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
aao00071  Fatty acid degradation
aao00280  Valine, leucine and isoleucine degradation
aao00310  Lysine degradation
aao00380  Tryptophan metabolism
aao00620  Pyruvate metabolism
aao00630  Glyoxylate and dicarboxylate metabolism
aao00640  Propanoate metabolism
aao00650  Butanoate metabolism
aao00900  Terpenoid backbone biosynthesis
aao01100  Metabolic pathways
aao01110  Biosynthesis of secondary metabolites
aao01120  Microbial metabolism in diverse environments
aao01130  Biosynthesis of antibiotics
aao01200  Carbon metabolism
aao01212  Fatty acid metabolism
aao02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ANH9381_0412
   00630 Glyoxylate and dicarboxylate metabolism
    ANH9381_0412
   00640 Propanoate metabolism
    ANH9381_0412
   00650 Butanoate metabolism
    ANH9381_0412
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ANH9381_0412
   00072 Synthesis and degradation of ketone bodies
    ANH9381_0412
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ANH9381_0412
   00310 Lysine degradation
    ANH9381_0412
   00380 Tryptophan metabolism
    ANH9381_0412
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ANH9381_0412
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ANH9381_0412
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ANH9381_0412
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aao04147]
    ANH9381_0412
Enzymes [BR:aao01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ANH9381_0412
Exosome [BR:aao04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ANH9381_0412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEW76438
Position
369447..370628
Genome map
AA seq 393 aa AA seqDB search
MENIVIVSAVRTPIGSFNGSLAAVSAVDLGATVIKEVIKRADIDSALVNEVIMGNVLQAG
IGQNPARQAALKAGVAKGIPSYTVNKVCGSGLKSVALGVQAIASGDADIVAAGGMESMSQ
APYILDHKIRSGVRMGNLPLRDSMIEDGLTCAINHYHMGITAENIAEQYGISREEQDQLA
LRSQTLASQAVQNGVFDKEIVSVTVKTRKGDIVVSRDEYPKPDTTAEGLAKLRPAFKKDG
TVTAGNASGINDGAAALLLMSESKANALGLKPLARIRGYASAGVDPAVMGLGPVPATQKA
LRKAGLTLDDIDLIEANEAFASQFLGVGRELHFNMEKTNIHGGAISLGHPIGASGARILV
TLLHNLIEKDKKLGLATLCIGGGEGISVIVERI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatatcgttatcgtcagcgcggtcagaacgccgatcggcagctttaacggcagt
cttgccgccgtcagtgcggttgatctgggcgctaccgtgatcaaagaagtgatcaagcgc
gcagacatcgacagcgccttggtcaacgaagtgattatgggtaatgtgctgcaagccggt
atcggacaaaaccctgcccgtcaagctgcactcaaagcgggcgtggcgaagggaattccg
tcctacactgtcaataaagtctgcggttcgggcttaaaaagcgtggcgttgggcgtgcaa
gccattgccagcggcgacgccgacatcgtggcggccggcggcatggaaagtatgagccaa
gcgccgtacattctggatcataaaatccgttccggcgtcagaatgggcaatctgccgttg
cgcgacagcatgatcgaagacggtctgacgtgcgccataaaccattaccacatgggcatt
acggcggaaaatatcgccgaacaatacggtatcagccgtgaggaacaggatcagcttgcg
ctgcgttcgcaaacccttgcctctcaagcggtgcaaaacggcgtattcgacaaagaaatc
gtatctgtcaccgtgaaaacccgcaaaggcgacatcgttgtctcccgcgacgaatacccg
aaacccgacaccacagcggaagggctggcgaagttaagaccggcattcaaaaaagacggc
accgtcaccgccggtaacgcctccggtattaacgacggcgccgccgcgttattgttaatg
agcgaaagcaaagcgaacgcattaggactgaaaccgctcgcccgtatccgcggttacgcc
agtgcaggagtcgatcctgccgtgatgggattggggccggtgccggcaacccagaaagcg
ctgcgcaaagcgggattgacgctcgacgatattgacctgatcgaagcgaacgaagccttc
gcctcgcaattcctcggcgtcggcagagaactgcatttcaatatggagaaaaccaatatc
cacggtggtgccatctcgctgggtcaccctatcggcgccagcggcgccagaattctggtg
acgctgctgcacaatctcattgagaaagacaaaaagctcggtctggcgaccctgtgtatc
ggcggcggggaaggcatttcagtgattgtcgaacggatctga

DBGET integrated database retrieval system