KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_0860Help
Entry
ANH9381_0860      CDS       T01651                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
aao00030  Pentose phosphate pathway
aao00480  Glutathione metabolism
aao01100  Metabolic pathways
aao01110  Biosynthesis of secondary metabolites
aao01120  Microbial metabolism in diverse environments
aao01130  Biosynthesis of antibiotics
aao01200  Carbon metabolism
Module
aao_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
aao_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:aao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ANH9381_0860
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ANH9381_0860
Enzymes [BR:aao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     ANH9381_0860
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     ANH9381_0860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 2-Hacid_dh_C F420_oxidored Shikimate_DH 3HCDH_N NAD_binding_11
Motif
Other DBs
NCBI-ProteinID: AEW76859
Position
complement(788341..789864)
Genome map
AA seq 507 aa AA seqDB search
MQLVAPKYLKSVQQVAPYQQEKKMSVKGDIGVIGLAVMGQNLILNMNDHGFKVVAYNRTT
SKVDEFLEGAAKGTNIIGAYSLEDLANKLEKPRKVMLMVRAGEVVDHFIDALLPHLEAGD
IIIDGGNSNYPDTNRRVAALREKGIRFIGTGVSGGEEGARHGPSIMPGGNEEAWRFVKPV
LQAISAKTEQGEPCCDWVGKDGAGHFVKMVHNGIEYGDMQLICEAYQFLKEGVGLSDEEL
QATFNEWRNTELDSYLIDITADILGYKDADGSRLVDKVLDTAGQKGTGKWTGINALDFGI
PLTLITESVFARCVSAFKDQRVAASKLFHKTIGKVEGDKKVWIEAVRKALLASKIISYAQ
GFMLIREASEHFNWNINYGNTALLWREGCIIRSRFLGNIRDAYEANPDLIFLGSDSYFKG
ILENAMSDWRKVVAKSIEVGIPMPCMASAITFLDGYTSARLPANLLQAQRDYFGAHTYER
TDKPRGEFFHTNWTGRGGNTASTTYDV
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
gtgcaacttgttgcaccaaaatatttaaaatcggtgcaacaagttgcaccctaccaacag
gagaaaaaaatgtcagtaaaaggcgacatcggtgttatcggcttagccgtgatggggcag
aacctcattttaaatatgaatgaccacgggtttaaagtggtggcgtataaccgtactact
tcaaaagtggacgagtttttagaaggcgcggcgaaaggcacgaacattatcggcgcgtat
tctttggaagatttggcgaacaaattggaaaaaccgcgtaaagtgatgttaatggtgcgt
gcgggtgaagtggtggatcactttattgatgcattgcttccgcatttagaagccggcgac
atcattatcgacggcggtaactccaattatccagacaccaaccgtcgcgtggcggcatta
cgtgaaaaaggcattcgtttcatcggcactggcgtttccggcggtgaagaaggtgcgcgt
cacggaccttccatcatgccgggcggtaacgaagaagcatggcgatttgtgaaaccggta
ttgcaagccatttccgccaaaaccgaacaaggcgaaccttgttgcgactgggtgggtaaa
gacggcgcaggtcatttcgtgaaaatggtgcataacggcatcgaatacggcgatatgcaa
ctgatttgtgaagcgtaccaattcctaaaagaaggcgtgggcttgtccgacgaagaattg
caagccaccttcaacgaatggcgcaataccgaattagacagctacttaattgacatcacc
gctgacattttgggctataaagacgcagacggcagccgtttggtggataaagtcttagat
accgcagggcaaaaaggaaccggcaaatggacagggatcaacgcattggatttcggcatt
ccgttgaccttaatcaccgaatccgtgttcgcccgttgcgtgtctgcctttaaagatcaa
cgcgtcgccgcaagcaaattgttccacaaaaccatcggtaaagtggaaggcgataaaaaa
gtgtggattgaagcggtgcgcaaagcattgttggcgtctaaaatcatttcttacgcacaa
ggctttatgttgattcgtgaagcgtccgaacacttcaactggaacatcaactacggcaac
acggcattgttatggcgtgaaggttgtattatccgtagccgtttcttgggcaacattcgt
gatgcgtacgaagccaatccggatctaattttcttaggctccgacagctacttcaaaggc
attttagaaaacgccatgagcgactggcgcaaagtggtggcgaaatccatcgaagtgggt
atcccaatgccttgtatggcatctgcgattaccttcttagatggctacacgtcagctcgt
ttgcctgcaaacttattgcaagcacaacgcgactacttcggcgcccacacctatgagcgt
accgacaaaccacgcggtgaattcttccacaccaactggacgggacgtggcggcaacacc
gcttccactacttatgatgtgtag

DBGET integrated database retrieval system