KEGG   Aggregatibacter actinomycetemcomitans ANH9381: ANH9381_1193Help
Entry
ANH9381_1193      CDS       T01651                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
aao  Aggregatibacter actinomycetemcomitans ANH9381
Pathway
aao00450  Selenocompound metabolism
aao00970  Aminoacyl-tRNA biosynthesis
aao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aao00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ANH9381_1193
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ANH9381_1193
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aao01007]
    ANH9381_1193
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aao03016]
    ANH9381_1193
Enzymes [BR:aao01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     ANH9381_1193
Amino acid related enzymes [BR:aao01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   ANH9381_1193
Transfer RNA biogenesis [BR:aao03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ANH9381_1193
 Prokaryotic type
   Other AARSs
    ANH9381_1193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1e tRNA-synt_1 tRNA-synt_1f Anticodon_1 DUF3005
Motif
Other DBs
NCBI-ProteinID: AEW77170
Position
1099314..1101374
Genome map
AA seq 686 aa AA seqDB search
MSNNKRKILVTCALPYANGPIHLGHMLEHIQADIWVRFQRMRGNEIHFVCADDAHGTPIM
LKADQMGITPEQLIDDVRQKHMADFAGFNISFDNYHSTHSEENRELSELIYNRLKENGFI
KSRTISQLYDPEKGMFLPDRFVKGTCPKCKSPDQYGDNCEVCAATYSPTELISPRSVVSG
ATPVMKDSEHFFFDLPSFEAMLKNWLGSGSLQSEVVNKMQEWFEAGLQQWDISRDAPYFG
FQIPNEEGKYFYVWLDAPIGYMASFKNLCKRESHIDFDGFWRKDSDAELYHFIGKDIMYF
HSLFWPAMLEGADFRKPSNIFVHGYVTVNGEKMSKSRGTFIQAATYLKYLDPECLRYYYA
AKLSNRIDDLDLNLEDFVQRVNTDLVNKLVNLASRNAGFIQKRFDGKLAASLDDQALFDE
FIAQSEQIAAYYENREFGKAIREIMALTDKANKYIDDKVPWVIAKEAGKDAELQAVCSMG
IQLFRVLMGYLKPVLPKLAERAEAFLQSKLTWANLAQPLLNHPIAPFKALFSRLDGKQIE
AMIEASKAENAQVNAPATAKSAVKNTGESAGGIEPIAETITIDDFAKLDLRVAKVLKCEA
VPESNKLLRFELDLGDHKLQVFSGIKAAYDKPEELEGRFVIMVANLAPRKMKFGVSEGMI
LSAGTGGADLFLLSADEGVTAGMQVK
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaataataaacgtaaaatcctcgtgacttgtgccttgccttatgccaatggtccg
atccatttagggcatatgctggaacatattcaagcggatatttgggtgcgttttcaacga
atgcgcggcaatgaaattcactttgtttgtgccgatgacgcgcatggcacgccgattatg
ttaaaagccgatcaaatgggcatcacgccggaacaattgattgatgatgtgcgccaaaaa
cacatggcggattttgccggctttaacatcagttttgataactaccactccacccatagc
gaagaaaatcgcgaactttccgaattaatttacaaccgcttgaaagaaaacggttttatt
aaaagccgtaccatttctcaattatatgatccggaaaaagggatgtttttgcccgatcgt
ttcgtaaaaggcacttgcccgaaatgtaaatcgcctgatcaatacggcgataactgtgaa
gtgtgcgcggcaacttacagcccgacggaattgattagtccgcgttctgtggtttccggt
gcgacgccggtgatgaaagactccgaacatttcttctttgatttgccgagttttgaagcc
atgttgaaaaactggctgggttccggttccttgcaatcggaagtggtgaataaaatgcag
gaatggtttgaagcgggtctgcaacagtgggacatttcccgtgacgcgccgtatttcggc
ttccaaattccgaatgaggaaggcaaatatttctatgtgtggctggatgcgccgattggc
tatatggcgtccttcaaaaatctgtgtaaacgcgaaagccacattgattttgacggtttc
tggcgcaaagacagcgacgcggaactgtatcatttcatcggcaaagacattatgtatttc
cacagcctgttctggccggcaatgctggaaggtgccgatttccgtaaaccgagcaatatt
ttcgtgcacggctatgtgacggtgaacggtgagaaaatgtcgaaatcccgtggcactttc
attcaagcggcaacttatttgaagtacttggatccggaatgtttgcgctattactacgcg
gcgaaactgagcaatcgcattgatgatttggatttgaacttagaggatttcgtacagcgc
gtgaatacggatttggtgaataaacttgttaatttggcttcccgtaatgccggctttatt
caaaaacgtttcgatggaaaattggcagcgagtttggacgatcaagccttatttgatgaa
tttattgctcaatcggaacagatcgccgcttattatgaaaaccgcgaattcggcaaagcc
attcgtgaaatcatggcgttaacggacaaagccaataaatacattgatgacaaagtccct
tgggtgattgccaaagaagcaggcaaagacgcggaattacaagcggtttgctctatgggc
attcagttattccgcgtgcttatgggctatttaaaaccggtgttgccgaaacttgccgaa
cgggcggaagccttcctgcaatctaaattaacttgggcgaatttggcgcaaccattgcta
aatcacccaatcgccccgttcaaagccttgttctcccgtttggacggcaaacaaattgaa
gccatgatcgaagcgtccaaagcggaaaatgcacaggtcaatgcacctgccacggcgaaa
agtgcggtcaaaaataccggtgaatctgcgggcggcattgagccgattgcggaaactatc
accattgacgattttgccaaattggatttacgtgtggcgaaagtgttgaaatgcgaagcc
gtgccggaatccaataaattattgcgttttgaattggatttaggcgatcacaaactccaa
gtgttctccggtattaaagcggcttacgacaaaccggaagaattagaagggcgttttgtg
attatggtggcaaacctggcaccgcgcaaaatgaaatttggtgtatccgaaggcatgatt
ttaagtgcgggaacgggcggtgccgatttattcttgttgtctgccgacgaaggcgtgacg
gcgggaatgcaggtgaagtag

DBGET integrated database retrieval system