KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_0414Help
Entry
NT05HA_0414       CDS       T00929                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
aap  Aggregatibacter aphrophilus NJ8700
Pathway
aap00430  Taurine and hypotaurine metabolism
aap00460  Cyanoamino acid metabolism
aap00480  Glutathione metabolism
aap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aap00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    NT05HA_0414
   00460 Cyanoamino acid metabolism
    NT05HA_0414
   00480 Glutathione metabolism
    NT05HA_0414
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aap01002]
    NT05HA_0414
Enzymes [BR:aap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     NT05HA_0414
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     NT05HA_0414
Peptidases and inhibitors [BR:aap01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   NT05HA_0414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept TnpV
Motif
Other DBs
NCBI-ProteinID: ACS96835
Position
complement(418549..420321)
Genome map
AA seq 590 aa AA seqDB search
MKKLATKCLFSSLALSIALAVGSPFAMANQPAATPSATELAAARYDSANDIFHPVYAKQG
MVASEQGLATQVGADILRQGGNAVDAAVAVGFALAVVLPNAGNIGGGGFMVLHDAKSGGN
YSVDFRETAPLKADRDMYLDKDGNVIDGRSLYTHFAVGVPGTVAGMEYALKKWGTMSLAQ
VIAPAIKLAEKGFVVGPMLASTLKEEKDNLGKWPQSKAIFFKNGEPLQEGDLLVQKDLAN
SLKLIAKQGAKAFYEGDIAKKIVAEMEKNQGLITLEDLKGYKVVERKPIEGEYRGYKVVT
MPPPSSGGVHLVQILNILERYPMADYGVNSAKSIHYLAEAMKLAYADRSEYLGDPDFVKI
PVTGLISKKYADELAQGISESKVKAASEIKPGKPQPYESDQTTHFSVMDKHGNAVAVTYT
LNFNFGSGIVAEGTGILLNDEMDDFSAKPGVPNAFGLIGGEANSIAPQKRPLSSMTPTLV
MKDNKPWLVTGSPGGARIITTVLQSIVNTIDHKMNPAEAIVTPRVHHQWLPDELRIEEGL
SPDTLSLLKAQGYNIKEKAPMGRVQIIQATENGFYGYSDPRNPEGKTVGY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactcgccaccaaatgcttatttagcagtttagcgctttctattgccctcgca
gtgggaagcccatttgccatggctaatcaaccggctgccacaccgtctgcaacggaattg
gcggcggcgcgttatgacagtgccaatgatatcttccatcctgtttatgccaaacagggc
atggttgccagtgaacaaggtttagccacccaagtgggtgcagacattttacgccaagga
ggtaacgctgttgacgccgctgttgccgtaggctttgcgctggcggtggtattgcctaat
gcgggcaatattggtggcggtggctttatggtgttacacgatgccaaaagcggcggcaat
tattccgttgatttccgtgaaactgcgccgttgaaagcagatcgtgatatgtatttggat
aaagacggtaacgtgattgacggtcgttctctttacactcattttgccgtaggcgtgccg
ggcactgttgccggtatggaatatgccttgaaaaaatggggcacaatgtccctcgctcaa
gtcattgcaccggccattaaattggcagaaaaaggctttgtagttggcccgatgttggca
agtacattaaaagaagaaaaagacaatttaggcaaatggccgcaatcaaaagccatcttc
tttaaaaatggtgagccgttgcaagaaggcgatttgttagtgcaaaaagacttggctaac
tctctaaaactgattgccaaacaaggtgcaaaagccttttatgaaggtgatatagccaag
aaaattgtcgctgaaatggagaaaaatcaaggcttaatcacgttggaagacttaaaaggc
tataaagtcgtggaacgtaaaccgattgaaggcgaatatcgcggttataaagtggtgact
atgccgccaccaagttccggcggagtgcatttagtgcaaattttgaatattttggaacgc
tatccaatggctgattacggcgtgaacagtgccaaaagcattcattatttggcggaagcg
atgaaacttgcctatgccgaccgttccgaatatttaggcgatcctgattttgtaaaaatt
ccggtaacaggcttaatttcgaaaaaatacgctgatgaattagcccaaggtattagcgaa
agtaaagtgaaagcggcaagtgaaatcaaaccgggtaagccgcaaccttacgaaagtgac
caaaccacccatttttccgttatggataagcacggtaatgcagtggcagtgacctatacc
ctcaactttaacttcggtagtggtattgtggcggaaggcacaggaattctgttaaatgac
gaaatggatgatttctccgccaaaccgggcgtgccaaacgcttttgggcttatcggcggt
gaagccaactccattgcgccgcaaaaacgtccgctttcatccatgacgccaaccttagtg
atgaaggacaataaaccgtggttagtcaccggtagcccgggtggcgcacgaattatcacg
accgtgctacaaagtatcgtcaataccatcgaccacaaaatgaacccggcagaagctatc
gtgaccccgcgcgttcatcatcaatggttgcctgatgagttacgtatagaagaaggctta
agtccggataccttgtctttactcaaagcacaaggttacaacattaaagaaaaagcccca
atgggacgggttcaaatcatccaagccaccgaaaatggcttctatggttattccgaccca
cgtaatcctgaagggaaaacggtggggtattaa

DBGET integrated database retrieval system