KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_0438Help
Entry
NT05HA_0438       CDS       T00929                                 

Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aap  Aggregatibacter aphrophilus NJ8700
Pathway
aap00020  Citrate cycle (TCA cycle)
aap00310  Lysine degradation
aap01100  Metabolic pathways
aap01110  Biosynthesis of secondary metabolites
aap01120  Microbial metabolism in diverse environments
aap01130  Biosynthesis of antibiotics
aap01200  Carbon metabolism
Module
aap_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aap00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NT05HA_0438
  Amino acid metabolism
   00310 Lysine degradation
    NT05HA_0438
Enzymes [BR:aap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NT05HA_0438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ACS96857
Position
447447..448652
Genome map
AA seq 401 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKKAGDAVKRDEVIVEIETDKVVLEVPAQADGIITEIL
QGEGATVVSKQLLGTLEDSVSAAAAAMEKTAEPTPADRRTEVPDEPHTSDVLSPGVRRLL
AELDVQATEVKGTGVGGRITREDVEAVIAKRAAAVKPAENTVSTVSYAARSEKRVPMTRL
RKRIAERLLEAKNNTAMLTTFNEVDMQPIMSLRKQYGEKFEKQHGVRLGFMSFYIKAVVE
ALKRYPEVNASIDGDDVIYHNYFDVSIAVSTPRGLVTPVLRDCDKLSMAEIEKSIKALAE
KGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPVAIEGQVVI
RPMMYLALSYDHRLIDGRESVGFLVTVKELLEDPTRLLLGI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgactattgaaattctcgtgccggatttgcccgagtcagttgccgatgccaccgttgcc
acttggcataaaaaagcaggggatgcggtgaaacgtgatgaagtgattgtggaaattgaa
accgacaaagtggtgcttgaagtgccggcacaagcggatggcattattaccgaaattttg
caaggtgagggtgctactgtcgtgagcaaacaattgctcggtacgttggaggattctgtt
tcagcagctgctgcagcaatggaaaaaacggcagaaccgaccccggcggatcgtcgtacc
gaagtgcctgatgaacctcatacctctgatgtgttaagcccgggagttcgccgtttattg
gcggaacttgatgtacaagccactgaggtgaaagggaccggcgtgggcggtcgtattacc
cgtgaagacgtcgaagcggttattgcaaaacgtgccgctgctgtgaaaccggcagaaaat
accgtcagcaccgtctcttatgccgcccgcagcgaaaaacgcgtgccgatgactcgtttg
cgtaaacgcattgcagaacgtttgttggaagccaaaaataacactgccatgttaaccaca
ttcaatgaagtggatatgcaaccgattatgagtttgcgtaaacaatatggtgaaaaattt
gaaaaacaacatggcgtacgtttgggttttatgtctttctacattaaagcggtggtggaa
gccttaaaacgttatccggaagtgaatgcctccattgacggtgatgacgtgatttatcac
aactattttgacgtaagtattgccgtttctacgcctcgcggtttggtgacgccggtattg
cgtgattgtgacaaactttctatggcggaaattgaaaaatctattaaggcgttggcagaa
aaaggccgtgatggcaaattgaccgtggaagatttaaccggcggtaactttacgatcact
aacggcggtgtgttcggttccttaatgtctacgccaatcatcaacccaccgcaaagtgcg
attttgggtatgcatgccattaaggatcgtccggtggctattgagggtcaagtggtgatt
cgtccaatgatgtacctggcgctaagttatgatcaccgtttaattgacgggcgggaatcc
gtcggtttcttagtgacggtaaaagagctgctggaagacccgacaagattattacttgga
atttaa

DBGET integrated database retrieval system