KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_1312Help
Entry
NT05HA_1312       CDS       T00929                                 

Definition
(GenBank) oxidoreductase domain protein
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
aap  Aggregatibacter aphrophilus NJ8700
Pathway
aap00010  Glycolysis / Gluconeogenesis
aap00071  Fatty acid degradation
aap00350  Tyrosine metabolism
aap00620  Pyruvate metabolism
aap00625  Chloroalkane and chloroalkene degradation
aap00626  Naphthalene degradation
aap00650  Butanoate metabolism
aap01100  Metabolic pathways
aap01110  Biosynthesis of secondary metabolites
aap01120  Microbial metabolism in diverse environments
aap01130  Biosynthesis of antibiotics
aap01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NT05HA_1312
   00620 Pyruvate metabolism
    NT05HA_1312
   00650 Butanoate metabolism
    NT05HA_1312
  Lipid metabolism
   00071 Fatty acid degradation
    NT05HA_1312
  Amino acid metabolism
   00350 Tyrosine metabolism
    NT05HA_1312
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NT05HA_1312
   00626 Naphthalene degradation
    NT05HA_1312
Enzymes [BR:aap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NT05HA_1312
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     NT05HA_1312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ACS97669
Position
1320498..1323119
Genome map
AA seq 873 aa AA seqDB search
MSNVENAVSPAQAEVNALVEKGLVALKEFRQLNQEQVNYIVAKASVAALDQHGVLAMHAY
EETGRGVFEDKATKNLFACEYVVNNMRHLKTVGVISENDVTGITEIADPVGVICGITPTT
NPTSTAIFKSLIALKTRNPIIFAFHPSAQQSSAHAARIVYEAAIAAGAPRNCIQWIEKPS
MEGTSALMKHPGIATILATGGNAMVEAAYSCGKPALGVGAGNVPAYVEKSANLKQAVHDI
VMSKSFDNGMVCASEQAAIVDEEIYNDFVKEMLSYGVYMVNKKEKAMLEEFMFGTKANSK
NYGGAKLNANVVGKPAAWIAEQAGFKVPPRTNILLAECKEVGEKEPLTREKLSPVLALIR
STSREDGLEKAEQMVEFHGLGHSAAIHTSDAELAKEFGKRVKAIRVIWNSPSTFGGIGDV
YNAFLPSLTLGCGSYGKNSVGNNVSAVNLINIKRVGRRRNNMQWFKVPSKIYFERDSIQY
LQSMGGMERVVIVTDRTMVDLGFVEKIAHQITARGNHVTYQLFADVEPDPSIETVRRGTE
LIRNYKPDTIIALGGGSAMDAAKVMWLFYEQPEVDFRDLVQKFMDIRKRAFKFPQLGRKA
RFIGIPTTSGTGSEVTPFAVITEGNKKYPIADYSLTPTVAIVDPALVITVPAHVAADTGL
DVLTHATEAYVSILASDFTDGLALQAIKLVFEFLEKSVKEKDPEARERMHNASTMAGMAF
ANAFLGMNHSLAHKIGGHFHTPHGRTNAILMPHVIRYNGTRPEKTATWPKYNYYKADVKY
QDIARMLGLPCATPEEGVRSYAQACYDLAVRCGIKMSFKEQGLDEKAWMDARRDVALLAF
EDQCSPANPRLPMVEDMQTILTRAYYGYDPKDY
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatgttgaaaatgcagtaagtcctgcacaagcagaagtgaatgctctggttgaa
aaaggtttggttgcgctgaaagaattccgccaattaaaccaagagcaggtgaactacatt
gtggcgaaagcctctgtggcggcgctggatcaacatggtgtgctggcgatgcacgcttat
gaagaaaccgggcgcggcgtatttgaggataaagcgaccaaaaatttattcgcctgtgaa
tatgtcgttaacaatatgcggcatttaaaaaccgtcggcgtaataagtgaaaatgatgta
acaggcatcaccgaaatcgccgatcctgtgggcgtcatctgtgggatcaccccgacaacc
aacccgacatccaccgccattttcaagtccctcattgcgctaaaaacccgtaacccaatc
atttttgccttccacccctccgcccaacaatcttccgcgcacgccgcccgcattgtgtat
gaagctgctattgccgccggtgcgccgagaaattgtattcaatggatcgaaaaaccatct
atggaaggcacatccgctttaatgaaacacccgggcatcgccaccatccttgctaccggc
gggaatgccatggtggaagctgcttattcctgcggcaaaccggcattgggcgtcggtgca
ggtaacgtgccggcttatgtggaaaaatccgccaacttaaaacaagcagtgcacgatatc
gtgatgtctaaatccttcgataacggcatggtgtgcgcctccgaacaggcggccatcgtc
gatgaagaaatctataacgattttgtaaaagaaatgctttcttacggcgtttatatggtg
aacaagaaagaaaaagccatgctggaagaattcatgttcggcacaaaagccaacagcaag
aactatggcggcgcgaaactgaatgccaatgtggtgggtaaacctgccgcctggattgcg
gaacaggcgggcttcaaagtgccaccgcgaaccaatattctgcttgccgaatgtaaagaa
gtgggcgaaaaagagccgctaacccgtgaaaaactttctccggtactggctttaattaga
tctacctcccgtgaagacggtcttgaaaaagcggaacaaatggtggaattccacggtttg
ggtcactccgccgccattcacacctccgatgcggagcttgccaaagaatttggtaaacgg
gtgaaagccattcgcgttatctggaactcgccttctaccttcggtggtatcggtgatgtg
tataacgccttcctgccttcccttacgttaggttgtggttcttatggtaaaaattccgtg
ggcaacaacgtaagtgcggtcaatttaattaacattaaacgagtaggcagacggagaaac
aatatgcaatggtttaaagtgccgtcaaaaatctattttgaacgggattcaattcaatat
cttcaatccatgggcggcatggaacgcgtggtcatcgtcaccgaccgtaccatggtggac
ttaggtttcgtagaaaaaatcgcccaccaaattacggctcgtggcaatcacgtaacctac
caattatttgccgatgtagaaccggatccgtccattgaaaccgtacgccgtggtacagag
ttaatccgtaactataaaccggataccattatcgccctgggtggtggttcggcaatggat
gcggcaaaagtgatgtggttattctatgaacaaccggaagtggatttccgcgatttggta
cagaaattcatggatatacgtaaacgcgcgtttaaattcccgcaactaggtcgtaaagcc
agatttatcggtataccgacaacatccggtaccggttctgaagtgacaccgtttgcggtt
atcaccgaaggtaataaaaagtacccgattgccgactactcgcttaccccgaccgtcgcc
attgtggatccggcattagtgatcactgtaccggcacatgtcgccgccgacaccggcttg
gacgtattaacccacgccaccgaagcttatgtatccattcttgccagcgacttcaccgat
ggtcttgcactgcaagccattaaactagtgtttgaattcttagaaaaatctgtgaaagaa
aaagatccggaagcgcgtgaaagaatgcacaatgcctccaccatggcgggtatggcattc
gccaatgcgttcttgggtatgaatcactcccttgcacacaaaatcggcggtcacttccat
acgccacatggacgcaccaatgcgattttaatgccgcacgttattcgttataacggtaca
cgtccggaaaaaactgcaacttggccgaaatacaactactacaaagcggatgtgaaatac
caagacatcgctcgtatgcttggtctgccttgtgctacaccggaagaaggtgtgcgttct
tatgcgcaagcctgctacgatttagcagtgcgttgtggtattaagatgtcctttaaagag
caaggcttggatgaaaaagcttggatggatgctcgtcgtgatgtggccctccttgccttt
gaagatcaatgttctccggcaaaccctcgcttaccgatggtagaagatatgcaaacgatt
ctaactcgagcttattatgggtatgatccgaaggattattaa

DBGET integrated database retrieval system