KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_1851
Entry
NT05HA_1851       CDS       T00929                                 

Definition
(GenBank) type VI secretion protein, family
  KO
K11901  type VI secretion system protein ImpB
Organism
aap  Aggregatibacter aphrophilus NJ8700
Brite
KEGG Orthology (KO) [BR:aap00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:aap02044]
    NT05HA_1851
Secretion system [BR:aap02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   NT05HA_1851
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ACS98178
Position
1837937..1838434
AA seq 165 aa
MSKTGSVAPKERINIKYTPATGNQQEEVELPLKLLVTGDFKGAPEETSLDERETVSVDKH
NFDAVMKQSALKIDMAVPNRLDDNAGNQDIGVSLKIESMADFSPDNIAKQVPQLNKLLEL
REALLALKGPMGNIPAFRNKLQDLISDQSAREALEKELAIILEKE
NT seq 498 nt   +upstreamnt  +downstreamnt
atgtcaaaaacaggttcagtcgcacctaaagagcgaattaatattaaatatacaccagcc
acaggaaaccaacaggaagaagttgagttaccactaaaattacttgtgacaggtgacttc
aaaggtgccccagaggaaacaagtcttgatgaaagagaaacagtctctgttgataaacac
aattttgatgcagtaatgaagcagtctgctttaaaaattgatatggcagtgccaaaccgt
ttagacgacaacgctggaaaccaagatattggtgttagcttaaaaattgaaagtatggca
gatttttctcctgataatattgctaagcaagttcctcaattaaataaattattagaatta
cgagaagctctcttagcattaaaaggtccaatgggaaacattcccgcatttagaaataaa
ttacaagatttaatttctgatcaaagtgcgagagaggcattagaaaaagaactcgctatt
attttagagaaagaataa

DBGET integrated database retrieval system