KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_1853
Entry
NT05HA_1853       CDS       T00929                                 

Definition
(GenBank) type VI secretion system lysozyme-related protein
  KO
K11905  type VI secretion system protein
Organism
aap  Aggregatibacter aphrophilus NJ8700
Brite
KEGG Orthology (KO) [BR:aap00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:aap02044]
    NT05HA_1853
Secretion system [BR:aap02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   NT05HA_1853
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: ACS98180
Position
1839950..1840366
AA seq 138 aa
MSFWNRIKEASKETKTIVKKSESEIISELIRSIKKNIELVLNSKQGCTLCAPDFGLRDFN
DSTATTRSLSQTIIADIRFNIERYEPRVRISRIEYIPDPYDVLQLNFRITCVVLLKQKNE
LTELNIILDSSNKRFKVV
NT seq 417 nt   +upstreamnt  +downstreamnt
atgagtttttggaatcgaattaaagaagcctcaaaagaaacaaaaacgattgttaaaaaa
agcgaatcagaaattattagtgaactgattcgctcaatcaagaaaaacatagaattggtt
ctcaactccaaacaagggtgcacattatgtgcacctgattttggtttaagggatttcaac
gattcaacagcaacaacacgtagtttaagccaaacaattattgctgatatccgctttaat
attgaacgttatgagcctcgagtaagaatctcaagaattgaatatattccggatccttat
gatgtcctacagcttaattttcgtataacgtgcgtcgtgttattaaagcagaaaaatgaa
ttaactgagttaaatattattttagatagttccaacaaaagatttaaggttgtgtag

DBGET integrated database retrieval system