KEGG   Arthrobacter alpinus R3.8: AOC05_04750Help
Entry
AOC05_04750       CDS       T04095                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
aaq  Arthrobacter alpinus R3.8
Brite
KEGG Orthology (KO) [BR:aaq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:aaq03009]
    AOC05_04750
Enzymes [BR:aaq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     AOC05_04750
Ribosome biogenesis [BR:aaq03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    AOC05_04750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: ALE91786
UniProt: A0A0M4QVK6
Position
1101948..1102871
Genome map
AA seq 307 aa AA seqDB search
MTETFTVPEEAAGARVDAALAALLGISRASAALLCSEGNVLQNGTAVGKSDKFKLGASVQ
VTVPERTNPLTVVIEPVEGLDILLDDDDFVVVDKPVGVAAHPSPGWVGPTVVGGLAAAGF
RISTSGAPERVGIVHRLDVGTSGAMVVAKTEHAYTVLKQAFRERTVKKVYHAMIQGLPDP
LTGTIDAPIGRHPGHDWRFAVIEGGRPSITHYEVLEAFGKASLVEVHLETGRTHQIRVHF
SALRHPCVGDLTYGADPRLAAELGLTRQWLHAQTLGFTHPSSGEWVEATSPYPQDLNYAL
DHLRDGH
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaacattcaccgttcccgaggaagccgccggtgcgcgcgtggatgcggcactg
gcggctctgctgggcatttcccgggccagcgccgctctactctgctccgagggcaacgtg
ctgcaaaacggtacggccgtgggcaagtcggacaagttcaagctgggggccagtgtccag
gtgacggttccggaacgcacaaacccgctcaccgttgtcatcgagccggtggagggccta
gatatcctgctcgacgacgacgactttgtggtggttgacaagccggttggcgtggccgcc
catccgtcaccgggctgggtgggtcccaccgtggtggggggacttgctgccgcaggattt
cgcatctcaacctcgggagccccggagcgggttggcattgtccaccgcctcgatgtgggt
acctcgggcgccatggtggttgccaagaccgagcacgcttatacggtgttgaagcaggcg
ttcagggaacgcaccgtgaaaaaggtgtaccacgccatgatccaggggcttcctgacccg
ttgacaggcacgatcgacgcgcccattggcaggcacccggggcacgactggcgattcgcc
gtcattgagggcgggcggccctccatcacccactacgaggtcctggaagcgttcggcaag
gcctccctggtggaagtccacctggaaacagggcggacgcaccaaatccgtgtccacttc
tcggccctgcgccacccctgcgttggcgacctcacctacggtgccgatccccgccttgcg
gctgaacttggcctgacacggcagtggctgcacgcccaaaccctaggattcacacatcca
tcctcgggggagtgggttgaagccaccagcccgtacccgcaggatttgaactatgccctg
gaccacctgcgcgacggacactaa

DBGET integrated database retrieval system