KEGG   Arthrobacter alpinus R3.8: AOC05_08970Help
Entry
AOC05_08970       CDS       T04095                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
aaq  Arthrobacter alpinus R3.8
Pathway
aaq00250  Alanine, aspartate and glutamate metabolism
aaq00410  beta-Alanine metabolism
aaq00430  Taurine and hypotaurine metabolism
aaq00650  Butanoate metabolism
aaq01100  Metabolic pathways
aaq01110  Biosynthesis of secondary metabolites
aaq01120  Microbial metabolism in diverse environments
aaq02024  Quorum sensing
Module
aaq_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:aaq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AOC05_08970
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AOC05_08970
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AOC05_08970
   00430 Taurine and hypotaurine metabolism
    AOC05_08970
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AOC05_08970
Enzymes [BR:aaq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AOC05_08970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 RNA_replicase_B
Motif
Other DBs
NCBI-ProteinID: ALE92419
UniProt: A0A0M3UGA5
Position
complement(2007844..2009211)
Genome map
AA seq 455 aa AA seqDB search
MSLHKHHPQHEEKITDSAFDGGVGSIPRHRLPRHTQDADAALRFVQDELMLDGNARQNLA
TFVTTWMEPQAATLIQASLEKNIIDKDEYPRSAEIERRCVNILANLWNASTPAGGEDAIG
CSTTGSSEAAMLAGMALKWRWRARREEAGANASKPNLVMGANVQVCWEKFARYWDVEARL
VPLDGATHLTADQAAAACDENTIAVVAVLGSTFDGSYEPVAEIAAALDALQASTGLDIPL
HVDAASGGFIAPFLDQELLWDFRLDRVKSINASGHKYGLVYPGVGWVVWRSSDDLPRELI
FSVDYLGGSMPTFALNFSRPASQVIAQYYTLVRYGFDGYQRIQQRARDIATTIAQGVEKL
GPFTLLSRGEELPVLAFKLTTPDGWDVYDLSHELRSFGWIVPAYPMPKGMADVDVLRVVV
RNGFTFDLAEMFLADLAKSVARLSGQQQARVAFHH
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgcacaagcaccatccccagcatgaggaaaagatcactgattcagccttcgac
ggcggggtggggtccatcccccggcaccgtttgccgcggcacacccaggacgcggacgcc
gctttgcgttttgttcaggacgagctgatgctggacggcaacgcacgccaaaacctggca
acgttcgtcaccacgtggatggaaccgcaggcggcaacactgatccaggcgtcgctggaa
aagaacatcatcgacaaggatgagtacccgcggtcggcagagatcgaacgtcgttgcgtg
aacatcctggcgaacctgtggaacgcttcgactcccgccgggggagaagacgccatcggg
tgttccacgacggggtcatccgaggccgctatgttggccgggatggcgctgaaatggcgg
tggcgagcacgccgggaagaagccggcgccaatgccagcaaacccaacctggtgatgggc
gccaacgtgcaggtctgttgggaaaaatttgcccgctattgggatgttgaggccaggctc
gtcccgctcgacggcgccacccacctgacagctgaccaagccgcggccgcgtgcgatgag
aacaccatcgctgttgtggcggtgctcggctcaacctttgatggctcctatgaaccggtg
gcggaaattgctgccgccctggacgcactgcaggccagcacgggccttgacattcccctg
cacgtggatgcggcctcgggcggattcatcgcccccttcctggaccaggagctcctgtgg
gacttccggctcgaccgggtgaagtccatcaacgcctccggacacaagtacggattggtg
taccccggggttggttgggtggtgtggcgcagctcggatgacttaccccgggagctgatc
ttcagcgtcgattacctgggcggttccatgcccacctttgccctgaacttctcccgaccc
gcctcccaggtcattgcccagtactacacgctggtccgctacggcttcgacggctaccag
cgcatccagcaacgtgcgcgcgacattgccacaaccattgcccagggtgttgaaaagctg
ggccccttcaccctcctgagccgtggggaggaactgcctgtcctggccttcaagctgacg
acgccggatggttgggacgtgtacgacctctcgcacgagctgcgcagcttcggctggatc
gtgcccgcctaccccatgcccaagggcatggccgacgtcgacgtgctacgtgtggtggtg
cggaacggcttcacttttgacctagctgaaatgttcctggcggatctggccaagtcggtg
gcccggctgtccgggcagcagcaggcccgggtggccttccaccactag

DBGET integrated database retrieval system