KEGG   Arthrobacter alpinus R3.8: AOC05_09715Help
Entry
AOC05_09715       CDS       T04095                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
aaq  Arthrobacter alpinus R3.8
Pathway
aaq00450  Selenocompound metabolism
aaq00970  Aminoacyl-tRNA biosynthesis
aaq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aaq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AOC05_09715
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AOC05_09715
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aaq01007]
    AOC05_09715
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aaq03016]
    AOC05_09715
Enzymes [BR:aaq01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AOC05_09715
Amino acid related enzymes [BR:aaq01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AOC05_09715
Transfer RNA biogenesis [BR:aaq03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AOC05_09715
 Prokaryotic type
   Other AARSs
    AOC05_09715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ALE92523
UniProt: A0A0M4QWX0
Position
complement(2167718..2169298)
Genome map
AA seq 526 aa AA seqDB search
MTSSESAKTPYYLTTAITYPNGDPHIGHAYEYIATDAMARFKRLDGFDVMFLTGTDEHGM
KIAQTAEKEGLTPKELVDRNVTIFKETHAALGITYDRFIRTTDADHYAASAALWKKMEEA
GDIYLGKYEGWYSVRDEAYYGEDETELREDGKRYSKVTDTLLTWTEEESYFFRLSNYQDK
LLALYADQPEFGAPRTRFNEVISFVKGGLEDLSVSRTTFDWGVPVPGNEKHVMYVWVDAL
TNYLTAVGYPDTESEAFQKYWPADVHIIGKDISRFHAVYWPAFLMSAGLELPKRVMIHGF
LHNNGVKMSKSLGNVVAPADWVAQYGLDQVRFFLLREVPFGADGSYNHDAVVSRMNSDLA
NNLGNLAQRSLSMVAKNCSGVVPTPGAFTSADEQILAAARALLEHSRHAYQGQDFHGSLE
KIWHVLGDTNAYFADQAPWVLRKTDVPRMETVLYVTMEVLRIVSILIQPVMPDAAAKLLF
VLGQGTAPDDAVRQFAAIAAPLVPGTVLPAPAPIFPKYEEPAPVEA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
gtgacatcttctgaatcggccaagacgccttactacctgaccaccgccatcacgtacccc
aacggtgacccgcacattgggcacgcctatgagtacattgccaccgacgccatggcacgc
ttcaagcgcctggacggcttcgatgtcatgttcctgacgggcacggatgagcacggcatg
aagatcgcgcagacggccgaaaaggaaggcctcacgcccaaggagctcgtggaccgcaac
gtcacgatcttcaaggagacgcacgccgctctgggcatcacttatgaccggttcatccgc
actacggacgccgaccactacgccgcctctgcggccctctggaagaagatggaagaggca
ggggatatttacctgggcaagtacgagggctggtactcggtccgcgacgaggcctactat
ggtgaggatgagaccgaactgcgcgaggacggcaagcgctactccaaggtcaccgacact
ttactgacctggacggaggaggaaagctacttcttccggctctccaactaccaggacaaa
ctgctggcgctctacgccgatcagcccgaattcggggccccgcgcacccgcttcaacgag
gtcatcagcttcgtcaagggcggcctggaggacctttcggtcagccgcaccaccttcgac
tggggcgttcctgtgcccggcaacgagaaacacgtcatgtacgtgtgggttgacgcgctg
accaactacctgaccgctgtgggctacccggacaccgaatccgaggcgttccaaaagtat
tggccggccgacgtgcacatcatcggcaaggacatctcccgcttccacgccgtctactgg
cccgcgttcctcatgtccgccgggctggaactgcccaagcgcgtcatgatccacggcttc
ctgcacaacaacggcgtcaagatgtccaagtccctgggcaatgtggtggccccggccgac
tgggtggcccagtacggtctggatcaggtccgcttcttcttgctgcgcgaggtccccttt
ggcgccgacggctcctacaaccacgacgcggtcgtgagccggatgaactccgatttggcc
aacaacctgggcaacctggcccagcgttcgctgtccatggtggccaagaactgctccggc
gttgtgccgacgccgggagcgttcacctccgcggatgagcagattctggccgcggcccgc
gccttgctggagcactcgcgccacgcctaccaggggcaggacttccacggctcgctggag
aagatctggcacgtccttggtgacaccaatgcctactttgccgaccaggccccctgggtg
ctgcgcaagaccgacgtgccccgcatggaaaccgtgctgtacgtgaccatggaggtgctg
cgcatcgtctcgatcctgatccagcccgttatgcccgacgccgcagcgaaactgcttttt
gttctgggccagggtactgcaccggacgacgctgttcgccagttcgctgccattgcggct
cctttggttcccggtactgtgctacccgccccggcgccgatcttccccaagtatgaggag
ccggcccccgtagaggcgtag

DBGET integrated database retrieval system