KEGG   Arthrobacter alpinus R3.8: AOC05_12780Help
Entry
AOC05_12780       CDS       T04095                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
aaq  Arthrobacter alpinus R3.8
Pathway
aaq03010  Ribosome
Brite
KEGG Orthology (KO) [BR:aaq00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AOC05_12780
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:aaq03011]
    AOC05_12780
Ribosome [BR:aaq03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AOC05_12780
  Bacteria
    AOC05_12780
  Archaea
    AOC05_12780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ALE92971
UniProt: A0A0M4RPV9
Position
complement(2835262..2835627)
Genome map
AA seq 121 aa AA seqDB search
MEAKASARHLRVTPMKARRVVNLIRGKQANEALAILKFAPQAASEPVFKVVQSAVANARV
LADRDSIAFNENDLYISEIFVDDGPTMKRFQPRAQGRAFQIKKRTSHVTVVVATPEKEEA
R
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggaagccaaggcaagtgcgcgtcatctgcgcgttacgcctatgaaggcccggcgcgtc
gtcaacctgattcgtggcaagcaggcgaatgaggcattggcgattttgaagtttgccccc
caggcagcttcggagccggtattcaaggtagtccagtccgcagtggctaacgcccgcgtt
ctggctgaccgcgacagcatcgcgttcaacgaaaatgatctgtacatcagcgagatcttc
gttgacgacggcccgaccatgaagcggttccagccgcgtgctcagggtcgcgcgttccag
atcaagaagcgcaccagtcacgtcaccgtggttgtcgctacacccgagaaagaggaggct
cgctaa

DBGET integrated database retrieval system